Search results for "Relevant"

showing 10 items of 93 documents

Neonatal representation of odour objects: distinct memories of the whole and its parts

2014

Extraction of relevant information from highly complex environments is a prerequisite to survival. Within odour mixtures, such information is contained in the odours of specific elements or in the mixture configuration perceived as a whole unique odour. For instance, an AB mixture of the element A (ethyl isobutyrate) and the element B (ethyl maltol) generates a configural AB percept in humans and apparently in another species, the rabbit. Here, we examined whether the memory of such a configuration is distinct from the memory of the individual odorants. Taking advantage of the newborn rabbit's ability to learn odour mixtures, we combined behavioural and pharmacological tools to specifically…

Olfactory perceptionMalerepresentationAmnesiaComplex MixturesGeneral Biochemistry Genetics and Molecular Biologyoryctolagus cuniculusodour mixturememorychemistry.chemical_compoundnewbornConditioning PsychologicalmedicineAnimals[ SDV.BDD ] Life Sciences [q-bio]/Development Biologyconfigural perception[SDV.BDD]Life Sciences [q-bio]/Development BiologyResearch ArticlesGeneral Environmental ScienceCommunicationAldehydesGeneral Immunology and Microbiologybusiness.industryEthyl maltolRepresentation (systemics)General MedicineOlfactory PerceptionchemistryAnimals NewbornPyronesOdorantsConditioningFemaleAmnesiaRabbitsPerceptmedicine.symptomPropionatesGeneral Agricultural and Biological SciencesBiological systemPsychologybusinessRelevant information
researchProduct

Demand for life annuities from married couples with a bequest motive

2006

The aim of this paper is to explain the ‘annuities puzzle’ in greater depth by introducing the bequest motive. It will try to determine whether this motive really is a relevant feature influencing the demand for life annuities from married couples. With this aim in mind, we develop an optimization model of the utility provided by purchasing a life annuity with contingent survivor benefit or a joint survivor life annuity. Our model is based on that first put forward by Brown and Poterba (2000), to which we have added elements from other models, such as Friedman and Warshawsky's (1990) and Vidal and Lejárraga's (2004), which include the bequest motive. This will enable us to calculate the ann…

Organizational Behavior and Human Resource ManagementEconomics and EconometricsActuarial scienceBequestStrategy and ManagementMechanical EngineeringLife annuityAnnuity functionMetals and Alloysjel:G23jel:H55Industrial and Manufacturing EngineeringPurchasingSpecificationAnnuity (American)Relevant featurejel:J26EconomicsCapitalization Pension Funds Retirement Utility.FinanceCapitalization
researchProduct

La vida cotidiana de los vecinos de Manila a través de sus testamentos e inventarios de bienes

2019

With the general objective indicated in its title, this work tries to highlight relevant aspects in the continuity of the Spanish domain in the Philippines, dependent on the maintenance of the Spanish capital. The inevitable selection of topics has lead the preferences of this work towards the residents collaboration to defend the city, the conversion of many of them into traders of exotic products and singular slaves owners, and their collaboration to an incredible miscegenation due to the ethnic variety. On the other hand, to follow the footsteps of the first generation of residents in Manila, at the end of the 16th century and during the 17th century, this work gives us some information …

PhilippinesRevista de historia moderna 529735 2019 45 7107712 La vida cotidiana de los vecinos de Manila a través de sus testamentos e inventarios de bienes García Abásolo [0210-9093 553 Estudis]and their collaboration to an incredible miscegenation due to the ethnic variety. On the other handAntonio With the general objective indicated in its titlesiglos xVI a xVIIIesclavitudfrom the 16th to the 18th centurywillsvida cotidianaat the end of the 16th century and during the 17th century:HISTORIA [UNESCO]vecinosdependent on the maintenance of the Spanish capital. The inevitable selection of topics has lead the preferences of this work towards the residents collaboration to defend the cityMexicothis work gives us some information about the flexibility of the Hispanic Monarchy to adapt to the social surroundings in Asia. FilipinasUNESCO::HISTORIA0210-9093 553 Estudis: Revista de historia moderna 529735 2019 45 7107712 La vida cotidiana de los vecinos de Manila a través de sus testamentos e inventarios de bienes García Abásoloto follow the footsteps of the first generation of residents in ManilaMéxicothe conversion of many of them into traders of exotic products and singular slaves ownersdaily lifeManilacommercethis work tries to highlight relevant aspects in the continuity of the Spanish domain in the Philippinesresidentscomerciotestamentosslavery 69 92
researchProduct

Experimental Quantum Probing Measurements With No Knowledge on the System-Probe Interaction

2020

In any natural science, measurements are the essential link between theory and observable reality. Is it possible to obtain accurate and relevant information via measurement whose action on the probed system is unknown? In other words, can one be convinced to know something about the nature without knowing in detail how the information was obtained? In this paper, we show that the answer is surprisingly, yes. We construct and experimentally implement a quantum optical probing measurement where measurements on the probes, the photons' polarization states, are used to extract information on the systems, the frequency spectra of the same photons. Unlike the pre-existing probing protocols, our …

PhysicsQuantum PhysicsPhotonfotonitmittausFOS: Physical sciencesObservablePolarization (waves)01 natural sciences010305 fluids & plasmasOptical probing0103 physical sciencesStatistical physicsQuantum Physics (quant-ph)010306 general physicskvanttifysiikkakvantti-informaatioRelevant informationQuantum
researchProduct

Methods of calculation for the T-matrix

1991

In the preceding section we have shown how the observables can be expressed in terms of the T-matrix elements or in terms of the multipole amplitudes OLλ(μjls) which contain all the relevant information on the dynamical properties of the system. For the calculation of these amplitudes a variety of different methods have been developed utilizing various kinds of approximations.

PhysicsTheoretical physicsT matrixAmplitudeSection (archaeology)ObservableVariety (universal algebra)Multipole expansionRelevant information
researchProduct

Coherence Checking and Propagation of Lower Probability Bounds

2003

In this paper we use imprecise probabilities, based on a concept of generalized coherence (g-coherence), for the management of uncertain knowledge and vague information. We face the problem of reducing the computational difficulties in g-coherence checking and propagation of lower conditional probability bounds. We examine a procedure, based on linear systems with a reduced number of unknowns, for the checking of g-coherence. We propose an iterative algorithm to determine the reduced linear systems. Based on the same ideas, we give an algorithm for the propagation of lower probability bounds. We also give some theoretical results that allow, by suitably modifying our algorithms, the g-coher…

Probability boxMathematical optimizationSettore MAT/06 - Probabilita' E Statistica MatematicaPosterior probabilitynon relevant gainLaw of total probabilityConditional probabilitybasic setsbasic sets; basic sets.; g-coherence checking; lower conditional probability bounds; non relevant gains; propagationCoherence (statistics)Conditional probability distributiong-coherence checking; lower conditional probability bounds; non relevant gainsImprecise probabilityTheoretical Computer Sciencelower conditional probability boundRegular conditional probabilitynon relevant gainspropagationlower conditional probability boundsGeometry and Topologyg-coherence checkingSoftwareMathematics
researchProduct

IL DIRITTO ALLO STUDIO NELLE LEGISLAZIONI REGIONALI.RIFLESSIONI A PARTIRE DALLA LEGGE REGIONALE SICILIANA. 10 DEL 20 GIUGNO 2019

2019

Analisi dei diversi sistemi regionali di tutela del diritto allo studio, partendo dall'analisi della nuova legge regionale siciliana n. 10 del 2019. Essa appare innovativa per molteplici aspetti, sebbene dubbi possono sollevarsi per quanto concerne la concreta attuazione soprattutto dal punto di vista economico, nonchè a causa della forte centralizzazione presso la Giunta regionale delle relative funzioni amministrative. Analysis of the different regional systems of protection of the right to study, starting from the analysis of the new Sicilian regional law n. 10 of 2019. It appears to be innovative in many respects, although doubts may arise as far as verifying the concrete implementation…

Settore IUS/08 - Diritto CostituzionaleAnalysis and comparison of the different regional systems for implementing the right to study with particular reference to the new Sicilian law n. 10 of 20 June 2019 which is noted for centralizing the relevant functions in the regional government.
researchProduct

Age differences in the irrelevant sound effect: A serial recognition paradigm

2015

In adults, the disrupting effect of irrelevant background sounds with distinct temporalspectral variations (changing-state sounds) on short-term memory performance was found to be robust. In the present study, a verbal serial recognition task was used to investigate this so-called Irrelevant Sound Effect (ISE) in adults and 8- to 10-year-old children. An essential part of the short-term memory impairment during changing-state speech is due to interference processes (changing-state effect) which can be differentiated from the deviation effect of auditory distraction. In line with recent findings (Hughes et al., 2013), our study demonstrates that the changing-state effect is not modulated by …

Sound (medical instrument)Age differenceslcsh:BF1-990Attentional controltask difficultyMemory performanceserial recognition taskAuditory distractionTask (project management)lcsh:PsychologyMemory impairmentthe irrelevant sound effectsense organsskin and connective tissue diseasesPsychologythe changing-state effectdevelopmentGeneral PsychologyCognitive psychologyPsihologija
researchProduct

Broadcasting Market's Developmental Change after European Court of Justice, October 4th 2011

2013

TV rightrelevant market antitrust law
researchProduct

Il ruolo del white paper sulle offerte al pubblico di cripto-attività alla luce della proposta MiCA

2022

La proposta MiCA, nel regolare il white paper sulle offerte di crypto-assets, sembra tenere in considerazione i benefici e i limiti dei sistemi di voluntary e di mandatory disclosure, non optando integralmente né per il primo, né per il secondo. In quest’ottica, se può condividersi l’approccio regolamentare diretto a graduare, a seconda della tipologia di token offerto, sia il contenuto che l’assoggettamento del documento a mera notifica o ad approvazione ex ante da parte dell’Autorità competente, dubbi sorgono in ordine all’indistinta allocazione dell’onere della prova in capo all’oblato, nei casi di violazione della disciplina del relativo white paper.

The MiCa proposal in the regular white paper on crypto-assets offerings seems to take into account the benefits and limitations of voluntary and mandatory disclosure systems not opting for either the former or the latter in full. On one hand one can agree with the regulatory approach aimed at adapting the content of the white paper to the type of token offered and at making the white paper either subject to mere notification or to the approval by the competent Authority depending on the asset offered. On the other hand doubts arise on the indistinct allocation of the burden of proof to the user in case of infringement of the relevant white paper framework.Settore IUS/04 - Diritto Commerciale
researchProduct