Search results for "Restriction"

showing 10 items of 527 documents

Impact of intermittent energy restriction on anthropometric outcomes and intermediate disease markers in patients with overweight and obesity: system…

2020

This systematic review aims to investigate the effects of intermittent energy restriction (IER) on anthropometric outcomes and intermediate disease markers. A systematic literature search was conducted in three electronic databases. Randomized controlled trials (RCTs) were included if the intervention lasted ≥12 weeks and IER was compared with either continuous energy restriction (CER) or a usual diet. Random-effects meta-analysis was performed for eight outcomes. Certainty of evidence was assessed using GRADE. Seventeen RCTs with 1328 participants were included. IER in comparison to a usual diet may reduce body weight (mean difference [MD]: −4.83 kg, 95%-CI: −5.46, −4.21; n = 6 RCTs), wais…

obesityPediatricsmedicine.medical_specialty030309 nutrition & dieteticsOverweightalternateday fastingIndustrial and Manufacturing Engineering03 medical and health sciences0404 agricultural biotechnologyWeight lossIntermittent fastingHumanscontinuous energy restrictionMedicineMeta-analysialternate-day fasting; continuous energy restriction; intermittent energy restriction; Meta-analysis; obesity; weight lossIn patientDisease markers0303 health sciencesbusiness.industryBody Weight04 agricultural and veterinary sciencesGeneral MedicineOverweightAnthropometrymedicine.disease040401 food scienceObesityMeta-analysisMeta-analysisweight lossmedicine.symptomEnergy Intakebusinessalternate-day fastingintermittent energy restrictionFood ScienceCritical Reviews in Food Science and Nutrition
researchProduct

Study of the mechanisms of oxidative stress, mitochondrial function and endoplasmic reticulum stress in obesity. Role in subclinical atherosclerosis …

2019

El aumento alarmante de la prevalencia de obesidad a nivel mundial y la enorme carga de enfermedad asociada ha generado una creciente demanda de estrategias para frenar la epidemia y / o mitigar los efectos dañinos de la obesidad sobre la salud. Para ello se requiere un compromiso firme y sinérgico por parte de todas las fuerzas sociales, no sólo para desarrollar estrategias preventivas, sino también para contribuir al conocimiento de los eventos patológicos y los mecanismos involucrados en el desarrollo de esta enfermedad. Por ello, el objetivo principal de la presente tesis doctoral es profundizar en los mecanismos subyacentes de la obesidad, especialmente en aquellos relacionados con el …

obesityleukocytes activationUNESCO::CIENCIAS DE LA VIDA::Biología molecularchronic periodontitis:CIENCIAS MÉDICAS ::Medicina interna::Endocrinología [UNESCO]pinitolendothelial dysfunction:CIENCIAS DE LA VIDA::Biología molecular [UNESCO]mitochondriaUNESCO::CIENCIAS MÉDICAS ::Patología::Arteriosclerosisinflammationcardiovascular diseasebotanical compoundsoxidative stresscaloric restriction:CIENCIAS DE LA VIDA::Fisiología humana ::Fisiología endocrina [UNESCO]:CIENCIAS MÉDICAS ::Patología::Arteriosclerosis [UNESCO]metabolismUNESCO::CIENCIAS MÉDICAS ::Medicina interna::EndocrinologíaUNESCO::CIENCIAS DE LA VIDA::Fisiología humana ::Fisiología endocrina
researchProduct

Intron variants of the p53 gene are associated with increased risk for ovarian cancer but not in carriers of BRCA1 or BRCA2 germline mutations

1999

Two biallelic polymorphisms in introns 3 and 6 of the p53 gene were analysed for a possible risk-modifying effect for ovarian cancer. Germline DNA was genotyped from 310 German Caucasian ovarian cancer patients and 364 healthy controls. We also typed 124 affected and 276 unaffected female carriers with known deleterious BRCA1 or BRCA2 germline mutation from high-risk breast-ovarian cancer families. Genotyping was based on PCR and high-resolution gel electrophoresis. German ovarian cancer patients who carried the rare allele of the MspI restriction fragment length polymorphism (RELP) in intron 6 were found to have an overall 1.93-fold increased risk (95% confidence internal (CI) 1.27–2.91) w…

p53AdultCancer Researchendocrine system diseasesAdolescentGenotypeGenes BRCA1BiologypolymorphismGermline mutationRisk FactorsGenotypemedicineTumor Cells CulturedHumansAlleleAllele frequencyGerm-Line MutationAgedGeneticsAged 80 and overBRCA2 ProteinOvarian NeoplasmsGenetic Carrier ScreeningCancerGenetic VariationRegular ArticleMiddle Agedmedicine.diseaseBRCA2 ProteinBRCA1Genes p53BRCA2IntronsNeoplasm Proteinsovarian cancerOncologyCase-Control StudiesCancer researchFemaleRestriction fragment length polymorphismOvarian cancergenetic susceptibilityTranscription FactorsBritish Journal of Cancer
researchProduct

El impacto de la política de visados sobre los flujos internacionales de turistas: Un análisis con datos de panel

2016

Using newly panel data on visa restrictions for the years 2000 and 2010 in a theory-grounded gravity model, we find a robust, causal negative impact of visa restrictions on international tourist flows. By destination, the detrimental impact of this type of barrier is observed for tourists going to developing countries (with the exception of East and South Asia), but not for those to developed ones. By country of origin of tourists, the impact of visa restrictions appears to be the same for tourists coming from developed and developing countries. These findings have important consequences in policy terms for tourism management at a regional level.

panel datagravity modellcsh:HB71-74F15visa restrictionsTurismeddc:330F10lcsh:HC10-1085lcsh:Economics as a scienceInternational tourismdeveloping countrieslcsh:Economic history and conditions
researchProduct

Parental Resources in Parents of Children with Special Needs (SNs) at the Time of COVID-19

2023

Background. The limitations imposed by governments for containing the spread of COVID-19 have affected familial relationships, especially those of families dealing with children with special needs or chronic illness conditions. The current study aims to better understand what pathological/disability condition has impacted parental resources, sense of competence, and perception of children’s executive functioning the most. Methods. A sample of 648 parents was asked to answer a survey assessing children’s condition (typical development, specific learning disorder, autism spectrum syndrome, chronic illness), parental resources, parenting sense of competence (distinguished into pare…

parental burnout; parenting sense of competence; COVID-19 restrictions; learning disabilitylearning disabilityparenting sense of competenceCOVID-19 restrictionsGeneral Medicineparental burnout
researchProduct

Effects of states governments restrictions related on Coronavirus disease (COVID-19) on states economy - comparison of Baltic States, Sweden, and Bel…

2021

In order to limit the spread of COVID-19, states have gradually implemented restrictions mandating school and kindergarten closures, postponing academic semesters and prohibiting visits to nursing homes to protect the elderly, borders were closed, states prohibited physical contact with more than one person from outside one's household, and other restrictions. This paper examines the economic effects of policies to contain Covid-19 in Baltic States by comparing they with experience of Sweden and Belarus where approach was less stringent and based more on social responsibility than legal obligations compared to the other European states

restrictionsBaltic Stateseconomyfirst stage of lockdown:SOCIAL SCIENCES::Business and economics [Research Subject Categories]Covid-19GDP
researchProduct

Cytotoxic necrotizing factor type 2 produced by virulent Escherichia coli modifies the small GTP-binding proteins Rho involved in assembly of actin s…

1994

Cytotoxic necrotizing factor type 2 (CNF2) produced by Escherichia coli strains isolated from intestinal and extraintestinal infections is a dermonecrotic toxin of 110 kDa. We cloned the CNF2 gene from a large plasmid carried by an Escherichia coli strain isolated from a lamb with septicemia. Hydropathy analysis of the deduced amino acid sequence revealed a largely hydrophilic protein with two potential hydrophobic transmembrane domains. The N-terminal half of CNF2 showed striking homology (27% identity and 80% conserved residues) to the N-terminal portion of Pasteurella multocida toxin. Methylamine protection experiments and immunofluorescence studies suggested that CNF2 enters the cytosol…

rho GTP-Binding ProteinsBacterial ToxinsMolecular Sequence DataRestriction Mapping[SDV.BC]Life Sciences [q-bio]/Cellular BiologyBiologyIn Vitro TechniquesSEQUENCE GENIQUEmedicine.disease_causeCell LineGTP-binding protein regulatorsGTP-Binding ProteinsmedicineEscherichia coliHumansCloning MolecularCytoskeletonEscherichia coliPeptide sequence[SDV.BC] Life Sciences [q-bio]/Cellular BiologyActinAdenosine Diphosphate RiboseMultidisciplinaryBase SequenceSequence Homology Amino AcidCytotoxinsBinding proteinEscherichia coli ProteinsMolecular biologyActinsCytosolTransmembrane domainActin CytoskeletonBiochemistryGenes BacterialFACTEUR CYTOTOXIQUE NECROSANTSequence AlignmentResearch Article
researchProduct

Blood Flow Restriction Exercise: Considerations of Methodology, Application, and Safety

2020

safetymedicine.medical_specialtyBFRPhysiologyIschemiaocclusionischemiaMuscle damageBlood flow restrictionlcsh:PhysiologyMuscle hypertrophyInternal medicinemuscle fiber degenerationPhysiology (medical)Occlusionmedicinemuscle hypertrophylcsh:QP1-981business.industryGeneral CommentaryhypoxiaBlood flowHypoxia (medical)medicine.diseaseCardiologyfatiguemedicine.symptombusinessMuscle fiber degenerationFrontiers in Physiology
researchProduct

Kritische Anmerkungen zur H/B-Dreiteilung Vorgangspassiv - Zustandspassiv - allgemeine Zustandsform

2004

sein-reflexivetilarefleksiivipassivpassiivisyntaksisyntaxpassiivirestriktiotpassiv restrictions
researchProduct

Intergenerational fitness effects of the early life environment in a wild rodent

2019

The early life environment can have profound, long‐lasting effects on an individual's fitness. For example, early life quality might (a) positively associate with fitness (a silver spoon effect), (b) stimulate a predictive adaptive response (by adjusting the phenotype to the quality of the environment to maximize fitness) or (c) be obscured by subsequent plasticity. Potentially, the effects of the early life environment can persist beyond one generation, though the intergenerational plasticity on fitness traits of a subsequent generation is unclear. To study both intra‐ and intergenerational effects of the early life environment, we exposed a first generation of bank voles to two early life…

sopeutuminenmaternal effectpredictive adaptive responseintergenerational plasticitymetsämyyräympäristötekijätfungipopulaatiodynamiikkasocial environmentsilver spoonsosiaalinen ympäristöearly lifefenotyyppiprotein restrictionpopulation densityasukastiheyskunto
researchProduct