Search results for "SKIN"

showing 10 items of 3630 documents

Hormone replacement therapy improves contractile function and myonuclear organization of single fibres from postmenopausal monozygotic female twin pa…

2013

Ageing is associated with a decline in muscle mass and strength leading to increased physical dependency in old age. Postmenopausal women experience a greater decline than men of similar age in parallel with the decrease in female sex steroid hormone production. We recruited six monozygous female twin pairs (55–59 years old) where only one twin pair was on hormone replacement therapy (HRT use = 7.8 ± 4.3 years) to investigate the association of HRT with the cytoplasmic volume supported by individual myonuclei (myonuclear domain (MND) size,) together with specific force at the single fibre level. HRT use was associated with a significantly smaller (∼27%; P < 0.05) mean MND size in muscle fib…

skinned fibersmyonuclear domain sizecontractility
researchProduct

Communicating interculturality in the workplace

2015

small groupscultural identitykulttuurienvälinen vuorovaikutuscritical intercultural communicationworkplace interactioninterpersonal relationshipstyöyhteisötkulttuurienvälinen viestintäinterculturalitysosiaalinen vuorovaikutustiimityöteamsihmissuhteetinterpersonal communicationtiimitulkomainen työvoimapienryhmätkeskinäisviestintäkielenkäyttöidentiteettityöelämäknowledge sharingkulttuuri-identiteettityötoveruuskulttuurienvälisyys
researchProduct

Vapaus valita? Nuorten pirstaloituva liikuntakulttuuri

2017

Keskustelu lasten ja nuorten liikkumisesta on muodostunut liikuntakulttuuripohdintojen kestoaiheeksi. Yhtäältä on huolestuttu varttuvan sukupolven liian vähäisestä – jopa terveyttä uhkaavasta – fyysisestä aktiivisuudesta. Toisaalta uusimmat sosialisaatiotulkinnat korostavat nuorison omia ruumiillisuuden valintoja. Tällöin perinteinen aikuisjohtoinen urheilukulttuuri on saanut rinnalleen monia nuorisokulttuurisen liikkumisen muotoja. nonPeerReviewed

sosiaalisuusharrastuksetliikuntaliikuntakulttuuriliikuntakasvatusvalistus (keskinäinen toiminta)tasa-arvourheilunuoretnuorten liikkuminennuorisokulttuuriArtikkelitelämyksellisyysterveyslapsetfyysinen aktiivisuus
researchProduct

Domain-Specific Risk and Public Policy

2018

We develop a method to estimate domain-specific risk. We apply the method to sickness insurance by fitting a utility function at the individual level, using European survey data on life satisfaction. Three results stand out. First, relative risk aversion increases with income. Second, marginal utility is higher in the sick state conditional on income, due to an observed fixed cost of sickness. Third, the domain-specificity of risk shifts the focus on the smoothing of utility, not consumption. The optimal policy rule implies that the replacement rates should be non-linear and decrease with income. nonPeerReviewed

sosiaalivakuutusstate-dependenceI13social insuranceddc:330risk aversionD02H55sickness absencesairauspoissaolotriskinarviointi (terveyteen liittyvä)risk
researchProduct

Microbial resources and sparkling wine differentiation : state of the arts

2022

Consumers’ increasing interest in sparkling wine has enhanced the global market’s demand. The pro-technological yeasts strains selected for the formulation of microbial starter cultures are a fundamental parameter for exalting the quality and safety of the final product. Nowadays, the management of the employed microbial resource is highly requested by stakeholders, because of the increasing economic importance of this oenological sector. Here, we report an overview of the production processes of sparkling wine and the main characterisation criteria to select Saccharomyces and non-Saccharomyces strains appropriate for the preparation of commercial starter cultures dedicated to the primary a…

sparkling wine; alcoholic fermentation; starter culture; non-Saccharomyces; Saccharomyces cerevisiae; autochthonous starters; regional wine; secondary fermentation; lactic bacteriaregional winenon-Saccharomyceslactic bacteriadigestive oral and skin physiologystarter culturefood and beveragesPlant ScienceSaccharomyces cerevisiaeBiochemistry Genetics and Molecular Biology (miscellaneous)alcoholic fermentationautochthonous starterssecondary fermentationsparkling winealcoholic fermentation;Food ScienceSettore AGR/16 - Microbiologia Agraria
researchProduct

Acute Effects of Tecar Therapy on Skin Temperature, Ankle Mobility and Hyperalgesia in Myofascial Pain Syndrome in Professional Basketball Players: A…

2021

(1) Background: Myofascial pain syndrome (MPS) is a clinical condition characterized by localized non-inflammatory musculoskeletal pain caused by myofascial trigger points. Diathermy or Tecar therapy (TT) is a form of noninvasive electro-thermal therapy classified as deep thermotherapy based on the application of electric currents. This technique is characterized by immediate effects, and its being used by high performance athletes. (2) Methods: A total of thirty-two participants were included in the study who were professional basketball players. There was a 15-person Control Group and a 17-person Intervention Group. TT was applied in the Intervention Group, while TT with the device switch…

sport injuriesBasketballdiathermyVisual analogue scaleHealth Toxicology and Mutagenesismedicine.medical_treatmentPilot ProjectsMyofascial pain syndrometrigger pointArticlerange of motionGastrocnemius musclemedicineHumansgastrocnemius musclebasketballMyofascial Pain Syndromesbusiness.industryPublic Health Environmental and Occupational HealthRDiathermymedicine.diseasethermographymedicine.anatomical_structureHyperalgesiaAnesthesiaHyperalgesiaMedicineAnkleAnklemedicine.symptomSkin TemperaturebusinessRange of motionInternational Journal of Environmental Research and Public Health
researchProduct

Helicobacter pylori in the dental plaque : is it of diagnostic value for gastric infection?

2006

Aim: The aim of the present study was the assessment of association of helicobacter pylori of dental plaque and stomach in a more homogenous population and also to determine the diagnostic value of dental plaque for gastric infection. Materials and Methods: Based on the results of Rapid urease test (RUT) on specimens from gastric antrum, 88 patients with symptoms of dyspepsia were assigned into two groups of infected and non-infected with helicobacter pylori. Supragingival plaque samples were collected from mandibular first and second molar area using and sterile curette and were investigated using RUT. Statistical analysis of data was performed using chi-square test and independent t-test.…

stomatognathic diseasesHelicobacter pyloridental plaquestomatognathic systemUNESCO::CIENCIAS MÉDICASdigestive oral and skin physiologyrapid urease test:CIENCIAS MÉDICAS [UNESCO]
researchProduct

Topic tacrolimus, alternative treatment for oral erosive lichen planus resistant to steroids : a case report

2006

The lichen planus is a mucocutaneous disease with unknown etiology and auto-immune pathogenia. There have been three variants of lichen planus: the reticular, the plaque-like and the atrophic-erosive lesions. It?s a chronic disease with acute relapses that generally affects more frecuently to women from the fourties. The diagnostic is based on the clinic identification of the lesions joined with the histopathologic study (basal cells hidropic degeneration, linfoplasmocitic infiltration and absence of displasy signs). The great number of therapeutic options are explained for its high prevalency (0.5-2%), its recurrence and its risk for malignant transformation. We present a case of oral eros…

stomatognathic diseasesOral erosive lichen planusintegumentary systemstomatognathic systemUNESCO::CIENCIAS MÉDICASskin and connective tissue diseases:CIENCIAS MÉDICAS [UNESCO]oral topic tacrolimus
researchProduct

Food oral processing and interindividual variability in human. Links between physiological parameters, release of sensory stimuli and perception of f…

2016

International audience; In human food oral processing is the first step in the digestive process. It prepares the food to be swallowed and then to undergo the process of digestion. During chewing, the food is comminuted by the combined action of chewing and saliva to form a bolus. The particle size of the bolus is reduced thanks to the action of the tongue and the teeth and the saliva is continuously produced by the salivary glands for humidifying and impregnating the food. Saliva impregnates and lubricates the bowl and also allows cohesion of the particles to prepare the step of swallowing. During food oral processing, the compounds responsible for food flavour and taste are released durin…

stomatognathic diseases[SDV.AEN] Life Sciences [q-bio]/Food and Nutritionstomatognathic systemdigestive oral and skin physiology[SDV.AEN]Life Sciences [q-bio]/Food and Nutrition
researchProduct

Gastroesophageal reflux diagnosed by occlusal splint tintion

2006

The gastroesophageal reflux (GER) disease is a very frequent digestive disorder, mainly characterised by the reflux of the gastric acidic content to the esophage in abnormal quantities. There are different situations that favour this situation but almost in all of them rely an incompetence of the esophagic sphincter. The clinical consequences are many, including oral manifestations. Among all of them the most frequent is the esophagitis followed by symptoms at the pharynx or larynx and finally, the oral cavity. At this level fundamentally we will find enamel and oral mucosa erosions. We report the case of a patient who was indirectly diagnosed of her esophague disease by the observation of …

stomatognathic diseasesdigestive oral and skin physiologyUNESCO::CIENCIAS MÉDICAS:CIENCIAS MÉDICAS [UNESCO]
researchProduct