Search results for "Sants"

showing 10 items of 262 documents

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Epilepsy in the Elderly

2009

Epilepsy is the third most common disease affecting the brain in the elderly. Current demographic trends will lead to an increased prevalence of epilepsy in the general population.A selective literature search revealed 102 relevant publications as of September 2008, 50 of which were original articles.The level of evidence was found to be very low. No guidelines, systematic reviews or meta-analyses are available, and there have been only three randomized, double-blind trials of treatment for epilepsy in the elderly. The seizures often escape clinical attention, because premonitory symptoms (aura) and secondary generalization into tonic-clonic seizures are both rarer in older patients. On the…

Aged 80 and overGeriatricsmedicine.medical_specialtyEpilepsyStatement (logic)business.industryConflict of interestDiagnostic testGeriatric assessmentReview ArticleGeneral Medicinemedicine.diseaseEpilepsymedicineHumansAnticonvulsantsPsychiatrybusinessGeriatric AssessmentAgedDeutsches Ärzteblatt international
researchProduct

Pharmacological heterogeneity of γ-aminobutyric acid receptors during development suggests distinct classes of rat cerebellar granule cells in situ

2001

The gamma-aminobutyric acid receptor (GABA(A)R) represents a ligand-gated Cl(-)-channel assembling as heteropentamere from 19 known subunits. Cerebellar granule cells contain a unique subset, namely the alpha1-, alpha6-, beta2-, gamma2- and delta-subunits. We studied their GABAergic pharmacology in situ using whole-cell patch-clamp recordings in brain slices and a modified Y-tube application system. The distribution of the EC50s for GABA in young (P8-P14) and medium aged animals (P15-P28) could be fitted with the sum of two Gaussian distributions with means of 60 and 185 microM and 27 and 214 microM, respectively. In older animals (P29-P48) the observed homogeneous range of sensitivities fi…

Agingmedicine.medical_specialtyCerebellumPatch-Clamp TechniquesLoreclezoleConvulsantsIn Vitro TechniquesBiologyBicucullineInhibitory postsynaptic potentialAminobutyric acidMembrane PotentialsGABA AntagonistsRats Sprague-DawleyCellular and Molecular Neurosciencechemistry.chemical_compoundFurosemideCerebellumInternal medicineDMCMmedicineAnimalsDiureticsGABA ModulatorsReceptorPharmacologyDiazepamLong-term potentiationReceptors GABA-ARatsElectrophysiologymedicine.anatomical_structureEndocrinologychemistryGABAergicAlgorithmsCarbolinesmedicine.drugNeuropharmacology
researchProduct

Chronic gout in the elderly

2013

Gout is the most common cause of inflammatory arthritis in men over 40 years old; it is a debilitating disease and, if untreated, can result in a chronic progressive disease, including tophaceous gout. In the elderly it represents a special issue, with notable clinical and therapeutic differences from the classical form with a systemic involvement. The burden of the disease increases particularly in the very old people, in whom arthritis, impaired gait and eyesight problems may enhance the related disability. Chronic gout moreover could aggravate heart and kidney disease and increase overall mortality and organ-related damage. Early diagnosis and appropriate treatment are important goals fo…

Agingmedicine.medical_specialtyGoutInflammatory arthritisArthritisDiseaseHyperuricemiaGout SuppressantsChronic gout Hyperuricemia Tophi Older ageRisk FactorsEpidemiologymedicineHumansHyperuricemiaIntensive care medicineLife StyleAgedbusiness.industrymedicine.diseaseGoutChronic DiseasePhysical therapyGeriatrics and GerontologybusinessProgressive diseaseKidney disease
researchProduct

Evidences of cannabinoids-induced modulation of paroxysmal events in an experimental model of partial epilepsy in the rat.

2009

The anticonvulsant effect of cannabinoids (CB) has been shown to be mediated by the activation of the CB(1) receptor. This study evaluates the anticonvulsant activity of (R)-(+)-[2,3-dihydro-5-methyl-3-(4-morpholinylmethyl) pyrrolo[1,2,3-de]-1,4-benzoxazin-6-Yl]-1-naphthalenylmethanone (WIN55,212-2, CB agonist) alone or preceded by the administration of N-(piperidin-1-yl)-5-(4-iodophenyl)-1-(2,4-dichlorophenyl)-4-methyl-1H-pyrazole-3-carboxamide (AM251, selective CB(1) antagonist) in an experimental in vivo model of complex partial seizures (maximal dentate gyrus activation - MDA) in the rat. WIN55,212-2 (21mgkg(-1)) exerted an anticonvulsant effect, significantly reduced by the pre-treatme…

AgonistAM251Malemedicine.medical_specialtyCannabinoid receptormedicine.drug_classmedicine.medical_treatmentMorpholinesNaphthalenesSettore BIO/09 - FisiologiaEpilepsyPiperidinesReceptor Cannabinoid CB1Internal medicineControlCannabinoid Receptor ModulatorsmedicineAnimalsRats WistarReceptorEpilepsyChemistryCannabinoidsGeneral NeuroscienceAntagonistBrainmedicine.diseaseCalcium Channel BlockersElectric StimulationBenzoxazinesRatsDisease Models AnimalMaximal dentate activationAnticonvulsantEndocrinologySettore BIO/14 - FarmacologiaRatPyrazolesAnticonvulsantsCannabinoidEpilepsies Partialmedicine.drugNeuroscience letters
researchProduct

Systemic administration of D-penicillamine prevents the locomotor activation after intra-VTA ethanol administration in rats.

2010

Although recently published studies seem to confirm the important role displayed by acetaldehyde (ACH), the main metabolite of ethanol, in the behavioral effects of ethanol, the origin of ACH is still a matter of debate. While some authors confer more importance to the central (brain metabolism) origin of ACH, others indicate that the hepatic origin could be more relevant. In this study we have addressed this topic using an experimental approach that combines local microinjections of ethanol into the ventral tegmental area (VTA) (which guarantees the brain origin of the ACH) to induce motor activation in rats together with systemic administration (i.p.) of several doses (0, 12.5, 25 and 50 …

AgonistLocomotor activityMalemedicine.drug_classMetaboliteCentral nervous systemAcetaldehydePharmacologyMotor Activitychemistry.chemical_compoundAlcohol-Induced Disorders Nervous SystemmedicineAnimalsRats WistarReceptorEthanolGeneral NeurosciencePenicillamineD-PenicillaminePenicillamineVentral Tegmental AreaCentral Nervous System DepressantsRatsVentral tegmental areaDAMGOBrain metabolism of ethanolDisease Models Animalmedicine.anatomical_structurechemistryBiochemistrySystemic administrationVTAmedicine.drugNeuroscience letters
researchProduct

Role of CB2 receptors and cGMP pathway on the cannabinoid-dependent antiepileptic effects in an in vivo model of partial epilepsy.

2014

This study aimed at providing an insight on the possible role of cannabi-noid (CB) type 2 receptors (CB2R) and cGMP pathway in the antiepileptic activity ofWIN 55,212-2, (R)-(+)-[2,3-dihydro-5-methyl-3-(4-morpholinylmethyl) pyrrolo[1,2,3-de]-1,4-benzoxazin-6-Yl]-1-naphthalenylmethanone, a non-selective CB agonist, in the maximal dentate activation (MDA) model of partial epilepsy in adult male rats. We evaluated the activity of a CB2 antagonist/inverse agonist AM630, [6-iodo-2-methyl-1-[2-(4-morpholinyl)ethyl]-1H-indol-3-yl](4-methoxyphenyl)methanone or 6-iodopravadoline, alone or in co-administration with WIN 55,212-2. Also, in the MDA model it was investigated the co-treatment of WIN55,212…

AgonistMaleIndolessGCmedicine.drug_classmedicine.medical_treatmentMorpholinesPharmacologyNaphthalenesSettore BIO/09 - FisiologiaHippocampusNitric oxideReceptor Cannabinoid CB2chemistry.chemical_compoundHippocampumedicineCannabinoid receptor type 2Inverse agonistAnimalsRats WistarReceptorCannabinoidCannabinoid Receptor AntagonistsCyclic GMPCannabinoid Receptor AgonistsElectrophysiology.ChemistryAntagonistElectric StimulationBenzoxazinesDisease Models AnimalNeurologyGuanylate CyclaseAnticonvulsantsNeurology (clinical)CannabinoidEpilepsies PartialSoluble guanylyl cyclaseTemporal Lobe Epilepsy AM630Epilepsy research
researchProduct

Actions of two GABAA receptor benzodiazepine-site ligands that are mediated via non-γ2-dependent modulation.

2011

The potent sedative-hypnotic zolpidem and the convulsant methyl-6,7-dimethoxy-4-ethyl-β-carboline-3-carboxylate (DMCM) act primarily by binding to the benzodiazepine site of the main inhibitory neurotransmitter receptor, the pentameric γ-aminobutyric acid type A receptor (GABA(A)). This binding depends critically on the wild-type F77 residue of the GABA(A) receptor γ2 subunit. Mice with γ2 subunit F77I point mutation (γ2I77 mouse line) lose the high-affinity nanomolar binding of these ligands as well as their most robust behavioral actions at low doses. Interestingly, the γ2I77 mice offer a tool to study the actions of these substances mediated via other possible binding sites of the GABA(A…

AgonistMaleZolpidemAzidesmedicine.drug_classPyridinesConvulsantsPharmacologyLigandsGABAA-rho receptor03 medical and health scienceschemistry.chemical_compoundBenzodiazepinesMice0302 clinical medicineDMCMmedicineAnimalsHumansHypnotics and SedativesBinding site030304 developmental biologyPharmacology0303 health sciencesBenzodiazepineBinding SitesBehavior AnimalGABAA receptorBrainLigand (biochemistry)Receptors GABA-AMice Inbred C57BLZolpidemProtein SubunitsHEK293 CellschemistryAutoradiographyFemale030217 neurology & neurosurgerymedicine.drugCarbolinesProtein BindingEuropean journal of pharmacology
researchProduct

Altered atypical coupling of γ-aminobutyrate type A receptor agonist and convulsant binding sites in subunit-deficient mouse lines

2001

We searched for subunit correlations for GABA(A) receptor-associated atypically GABA-insensitive [35S]TBPS binding. The homomeric beta3 subunit receptors could be excluded, as GABA-insensitive [35S]TBPS binding was present in beta3-/- mice. Localization of GABA-insensitive [35S]TBPS binding correlated best with those of delta, alpha4 and alpha6 subunit mRNAs. The amounts of GABA-insensitive [35S]TBPS binding components were increased in delta-/- mice, but dramatically reduced in alpha6-/- mice, suggesting a role for alpha6 but excluding delta subunits.

Agonistmedicine.medical_specialtymedicine.drug_classProtein subunitMolecular Sequence DataConvulsantsBiologySulfur Radioisotopesmedicine.disease_causeMiceRadioligand AssayCellular and Molecular NeuroscienceInternal medicinemedicineAnimalsHomomericRNA MessengerBinding siteReceptorGABA AgonistsMolecular BiologyBrain ChemistryMice KnockoutMutationBinding SitesGABAA receptorBridged Bicyclo Compounds HeterocyclicReceptors GABA-AMolecular biologyEndocrinologynervous systemConvulsantMolecular Brain Research
researchProduct

FGFR1-5-HT1A receptor heterocomplexes: relevance for neuroplasticity and depression

2014

Antidepressants: basic Depression: basic ReceptorsSettore BIO/09 - Fisiologia
researchProduct