Search results for "Sel"

showing 10 items of 14031 documents

Unlocking mixed oxides with unprecedented stoichiometries from heterometallic metalorganic frameworks for the catalytic hydrogenation of CO 2

2021

[EN] Their complex surface chemistry and high oxygen lattice mobilities place mixed-metal oxides among the most important families of materials. Modulation of stoichiometry in mixed-metal oxides has been shown to be a very powerful tool for tuning optical and catalytic properties. However, accessing different stoichiometries is not always synthetically possible. Here, we show that the thermal decomposition of the recently reported metal-organic framework MUV-101(Fe, Ti) results in the formation of carbon-supported titanomaghemite nanoparticles with an unprecedented Fe/Ti ratio close to 2, not achievable by soft-chemistry routes. The resulting titanomaghemite phase displays outstanding catal…

titanomaghemiteMaterials scienceRWGSNanoparticle02 engineering and technology010402 general chemistry01 natural sciencesReverse water-gas shiftWater-gas shift reactionMixed oxidesCatalysisTitanomaghemitePhase (matter)[CHIM.CRIS]Chemical Sciences/CristallographyPhysical and Theoretical Chemistrymixed oxidesOrganic ChemistryThermal decomposition[CHIM.MATE]Chemical Sciences/Material chemistry[CHIM.CATA]Chemical Sciences/Catalysis021001 nanoscience & nanotechnology0104 chemical sciencesChemical engineeringChemistry (miscellaneous)reverse water-gas shiftMetal-organic framework0210 nano-technologySelectivityMOF-mediated synthesisStoichiometry
researchProduct

Voltammetric Detection of Lead(II) Using Amide-Cyclam- Functionalized Silica-Modified Carbon Paste Electrodes

2009

2-(4,8,11-Triscarbamoylmethyl-1,4,8,11-tetraazacyclotetradec-1-yl)acetamide (TETAM) derivatives bearing 1, 2, or 4 silylated arms have been synthesized and grafted to the surface of silica gel and ordered mesoporous silica samples. The resulting organic-inorganic hybrids have been incorporated into carbon paste electrodes and applied to the preconcentration electroanalysis of Pb(II). The attractive recognition properties of these cyclam derivatives functionalized with amide pendent groups toward Pb(II) species and the highly porous structure of the adsorbents can be exploited for the selective and sensitive detection of the target analyte. Various parameters affecting the preconcentration a…

titrationsynthesisDPVInorganic chemistrydetectionR4(14)aneN4extractanturea02 engineering and technology01 natural sciencesAnalytical Chemistrychemistry.chemical_compoundAdsorptionSBA15sensorAmideCyclamElectrochemistryComputingMilieux_MISCELLANEOUSsolid/liquid extractionDetection limitleadSilica gelsilica gel010401 analytical chemistryTETAM[CHIM.MATE]Chemical Sciences/Material chemistryMesoporous silica021001 nanoscience & nanotechnologygraftingamide0104 chemical sciencesCarbon paste electrodechemistry[ CHIM.MATE ] Chemical Sciences/Material chemistryKieselgel 600210 nano-technologyAcetamideElectroanalysis
researchProduct

The role of oral health professionals in tobacco cessation

2008

Tobacco is the major independent risk factor for the development of oral cancer and potentially malignant lesions. It is also involved in the pathogenesis of periodontal disease. The members of the dental team can play an effective role in tobacco preventing and cessation as they provide preventive and therapeutic services to a basically healthy population on a regular basis. In this paper, the authors present specific strategies to guide oral health professionals (i.e. dentist and dental hygienist) providing smoking cessation interventions. The “Five A’s” strategic approach represents a brief and effective protocol for smoking cessation that members of dental team can use with all patients…

tobacco cessation oral health professionals counsellingSettore MED/28 - Malattie Odontostomatologiche
researchProduct

Tobacco-use cessation counselling in dental practice: an evidence-based approach

2010

tobacco cessation counsellingSettore MED/28 - Malattie Odontostomatologiche
researchProduct

Self-regulatory efficacy and sources of efficacy in elementary school pupils: Self-regulatory experiences in a population sample and pupils with atte…

2019

In this study, we examined self-regulatory efficacy and sources of self-efficacy (mastery experiences, vicarious experiences, social persuasion and physiological/emotional states) and the relationships between self-efficacy and its sources among elementary school pupils. Two groups were compared: a population sample (PS, N = 1284) and pupils with difficulties in attention and executive functions (AED, N = 61). Data gathered from self-report questionnaires indicated that pupils in the PS group had more positive efficacy beliefs and mastery experiences and fewer negative physiological/emotional states than the AED group. Analyses showed strong connections between sources and self-regulatory e…

toiminnanohjaus (psykologia)Social PsychologyPopulation samplemedia_common.quotation_subjectitsesääntelyomatoimisuusEducationDevelopmental psychologyDevelopmental and Educational PsychologyADHDta5160501 psychology and cognitive sciencesFunction (engineering)ta515media_common4. Education05 social sciencesalakoululaiset050301 educationSocial persuasionVariance (accounting)Executive functionsself-regulatory efficacyattention deficitsexecutive function deficitssources of self-efficacyPsychology0503 education050104 developmental & child psychologyLearning and Individual Differences
researchProduct

Lähteikköjen luonnontilan ja sammallajiston muutokset Salpausselällä 1953-2006

2007

toimintasammaletkoostumuslähteetSalpausselkämaksasammaletihminenlajitluontosuhdemuutoksetlehtisammalet
researchProduct

Pyörätuolilla liikkuvien selkäydinvammaisten olkapääkipujen yhteys ikään ja vamma-aikaan

1999

toimintakykyolkapääkipuvanheneminenselkäydinvammaiset
researchProduct

Randomized controlled trial of postoperative exercise rehabilitation program after lumbar spine fusion: study protocol

2012

Abstract Background Lumbar spine fusion (LSF) effectively decreases pain and disability in specific spinal disorders; however, the disability rate following surgery remains high. This, combined with the fact that in Western countries the number of LSF surgeries is increasing rapidly it is important to develop rehabilitation interventions that improve outcomes. Methods/design In the present RCT-study we aim to assess the effectiveness of a combined back-specific and aerobic exercise intervention for patients after LSF surgery. One hundred patients will be randomly allocated to a 12-month exercise intervention arm or a usual care arm. The exercise intervention will start three months after su…

toimintakykysatunnaistettu kontrolloitu tutkimusselän jäykistysleikkauselämänlaatuterapeuttinen harjoittelu
researchProduct

Liikuntaintervention yhteys selkäkipuun, subjektiiviseen toimintakykyyn ja fyysiseen aktiivisuuteen pitkittyneessä selkäkivussa : viiden vuoden seura…

1999

toimintakykyselkäsairaudetliikunnallinen harjoittelumittauskipuliikuntafyysinen aktiivisuus
researchProduct

Ikääntyvien käsityksiä toimintakyvystään ja kotona selviytymisestään sekä ikäihmisten avomuotoisen kuntoutuksen kehittämishankkeesta

2001

toimintakykyselviytyminenfyysinen toimintakykykuntoutuskotipalvelutikääntyneetsuoriutuminen
researchProduct