Search results for "Squat"

showing 10 items of 87 documents

Reliability and concurrent validity of the Velowin optoelectronic system to measure movement velocity during the free-weight back squat

2018

The objective of this study was to explore the reliability and concurrent validity of the Velowin optoelectronic system to measure movement velocity during the free-weight back squat exercise. Thirty-one men (age = 27.5 ± 3.2 years; body height = 1.76 ± 0.15 m; body mass: 78.3 ± 7.6 kg) were evaluated in a single session against five different loads (20, 40, 50, 60 and 70 kg) and three velocity variables (mean velocity, mean propulsive velocity and maximum velocity) were recorded simultaneously by a linear velocity transducer (T-Force; gold-standard) and a camera-based optoelectronic system (Velowin). The main findings revealed that (1) the three velocity variables were determined with a h…

Motion analysisbusiness.industryComputer scienceMovement (music)Concurrent validityMeasure (physics)Resistance trainingSquat030229 sport sciencesKinematics03 medical and health sciences0302 clinical medicineOptoelectronicsbusiness030217 neurology & neurosurgerySocial Sciences (miscellaneous)Reliability (statistics)International Journal of Sports Science & Coaching
researchProduct

The influence of the stomatognathic system on explosive strength: A pilot study

2015

[Purpose] Recent findings suggest there is an interesting interaction between the stomatognathic system and the musculoskeletal system. The aim of this study was therefore to examine the influence of the temporomandibular joint on the explosive strength of the lower limbs. [Subjects and Methods] An observational study was carried out. The subjects were 60 male football players who voluntarily participated in the investigation. After a warm-up phase of 10 minutes, each participant performed three Squat Jumps (SJ) with different mandible positions: mouth closed and mouth open. SJ heights were recorded using a Sensor Medica force platform and the FreeMed system. [Results] Sixty participants we…

OrthodonticsFootball playersbusiness.industryDental occlusionExplosive strengthSquatPhysical Therapy Sports Therapy and Rehabilitation030206 dentistryBioinformaticsExplosive strengthDental occlusionTemporomandibular jointMouth closed03 medical and health sciences0302 clinical medicineStomatognathic systemmedicine.anatomical_structureMedicineForce platformOriginal ArticleStomatognathic systembusiness030217 neurology & neurosurgery
researchProduct

Effects of short inter-repetition rest periods on power output losses during the half squat exercise

2016

BACKGROUND: Cluster training is being increasingly used to develop muscular power. OBJECTIVE: To determine the effects of short inter-repetition rest (IRR) periods on the capacity to maintain maximal levels of power output. METHODS:In afirst session, 16 active-duty soldiers performed a progressive loading test toestablish the load linked tomaximal power (optimal load, OL), and the half squat 1-repetition maximum. In Session 2, six individual sets of repetitions performed to failure (or a maximum of 20 repetitions) were conducted using the loads OL, low (LL, 15% below OL), and high (HL, 15% above OL) as quickly as possible. For each load, participants performed one set without rest between r…

Power lossRepetition (rhetorical device)BiophysicsPhysical Therapy Sports Therapy and RehabilitationSquat030229 sport sciences030204 cardiovascular system & hematologyMuscular power03 medical and health sciences0302 clinical medicineMuscle powerRest (finance)StatisticsOrthopedics and Sports MedicinePower outputMathematicsIsokinetics and Exercise Science
researchProduct

Effects Of Whole Body Vibration In Patients With Chronic Obstructive Pulmonary Disease - A Randomized Controlled Trial

2012

Summary Introduction To date endurance and strength training are established and evidence-based exercise methods in patients with chronic obstructive pulmonary disease (COPD). There is an unmet need for further research in new and complementary exercise modalities. Additional whole body vibration training during pulmonary rehabilitation may be such a new approach that has not yet been investigated in patients with COPD. Methods Eighty-two patients (65 ± 9 yrs, FEV 1 pred. 38 ± 11%, female 51%) with COPD in GOLD stage III to IV assessed for a 3-week inpatient multidisciplinary rehabilitation program were on top randomly assigned to one of two intervention groups: (1) 3 × 3 min of bilateral d…

Pulmonary and Respiratory MedicineMalemedicine.medical_specialtyTime FactorsStrength trainingmedicine.medical_treatmentSquatWalkingVibrationlaw.inventionPulmonary Disease Chronic ObstructiveRandomized controlled trialQuality of lifelawTrainingHumansMedicineWhole body vibrationIn patientPulmonary rehabilitationProspective StudiesProspective cohort studyExercisePhysical Therapy ModalitiesAgedCOPDExercise Tolerancebusiness.industryChronic obstructive pulmonary diseaseMinimal clinically important differencemedicine.diseaseRespiratory MusclesExercise TherapyRespiratory Function TestsPulmonary rehabilitationTreatment OutcomePhysical therapyFemalebusinessWhole body vibrationA107. ASSESSMENT, EXERCISE TRAINING AND OUTCOMES
researchProduct

Effects of heavy barbell hip thrust vs back squat on subsequent sprint performance in rugby players

2020

The objective of this research was to compare the effect of Post-Activation Performance Enhancement (PAPE) exerted on the back squat (BS) versus the barbell hip thrust (HT) on the sprint performance (5- and 10-m). 17 male amateur rugby players participated in the study (age 22.14 ± 2.52 years; body mass 81.06 ± 9.6 kg; height 1.78 ± 0.05 m). All participants performed a dynamic maximum strength test (3RM) in BS and HT at maximum speed. Two randomized sessions were performed inducing PAPE using BS or HT trough three series with three repetitions at 85% 1RM eight minutes before the sprint tests. An ANOVA of repeated measurement, found no differences in the time for 5-m (F = 0.398, P = 0.537, …

QH301-705.5Heavy loadpost-activation performance enhancementPhysical Therapy Sports Therapy and RehabilitationSquatPost-activation performance03 medical and health sciences0302 clinical medicineAnimal sciencePhysiology (medical)Orthopedics and Sports MedicineBiology (General)enhancementMathematicsOriginal Papermuscle powerResistance training030229 sport sciencesphysical performancewarm-up exerciseSprintPhysical performanceMuscle powerSports medicineAnalysis of varianceresistance trainingPerformance enhancementRC1200-1245030217 neurology & neurosurgeryBiology of Sport
researchProduct

EMG amplitude of the biceps femoris during jumping compared to landing movements.

2013

Abstract Hamstrings injury is a common occurrence in athletic performance. These injuries tend to occur during a deceleration or landing task suggesting the negative work may be a key component in hamstrings injury. The purpose of this study was to investigate the muscular activity (EMG) of the biceps femoris (BF) in different phases (concentric vs. eccentric) of a Counter Movement Jump (CMJ), Squat Jump (SJ) and the Braking Phase (BP) of a landing task. Twelve female volleyball players performed 5 CMJs, SJs and BPs while surface EMG was recorded using a MuscleLab (BoscoSystemTM, Norway). EMG values were normalized to an maximal voluntary contraction. A repeated measures analysis of varianc…

Squat jumpmedicine.medical_specialtyMultidisciplinarymedicine.diagnostic_testbusiness.industryElectromyographyResearchRepeated measures designHamstring injuriesElectromyographyConcentricmedicine.disease_causeCounter movement jumpBicepsStretch shortening cycleJumpingPhysical medicine and rehabilitationSquat jumpmedicinePhysical therapyEccentricStretch-shortening cyclebusinessBraking phaseSpringerPlus
researchProduct

Relationship between off-ice testing variables and on-ice speed in women's collegiate synchronized figure skaters: implications for training.

2010

The purpose of the current investigation was to identify any existing relationships between off-ice performance measures and on-ice performance quantified by speed and acceleration. Twenty-seven women (age 19 +/- 1 year; body mass (59.5 +/- 6.8 kg; height 164.6 +/- 6.35 cm; body fat 23.2 +/- 3.9%) who were collegiate synchronized figure skaters volunteered for the investigation. To examine the relationship between off-ice performance and on-ice speed and acceleration, collegiate synchronized skaters were evaluated on various performance tests over a 1-week period. Off-ice tests completed were peak torque for hip abduction and adduction, 40-yard sprint, vertical jump height, 30-second slide …

Training (meteorology)STRIDEPhysical Therapy Sports Therapy and RehabilitationSquatGeneral MedicineAthletic PerformanceBody Mass IndexAccelerationVertical jumpYoung AdultSprintSkatingDashStatisticsExercise TestPlyometricsHumansOrthopedics and Sports MedicineFemaleExerciseMathematicsJournal of strength and conditioning research
researchProduct

L’« affaire CPAM ». À propos d’une mobilisation autour de l’expulsion d’un « squat de migrants »

2020

National audience

[SHS.ANTHRO-SE] Humanities and Social Sciences/Social Anthropology and ethnologyaffairesquatmanifestationsmilitantismemigrantsréflexivité[SHS.ANTHRO-SE]Humanities and Social Sciences/Social Anthropology and ethnologyproblème publicmigrationcitoyennetéComputingMilieux_MISCELLANEOUS
researchProduct

Negotiating informal housing in Metro Manila : forging communities through participation

2016

This research project examines socialized housing programs available to informal settlers in the megacity of Metro Manila, Philippines, and the socio-political and institutional relationships that enable or impede access to housing. Megacities are urban agglomerations with populations of over 10 million inhabitants and Asia and Africa contain some of the fastest growing cities in the world. The challenge of Southern governments to meet the housing needs of hundreds of thousands of urban poor is exacerbated by the influx of migrants into these economic hubs, the scarcity of land for low-income housing and the inequalities and infrastructure deficiencies in developing countries’ cities. The s…

asuinyhteisötsocial preparationMetro ManilayhteisöasuminenpovertymegacitiespaikallisyhteisötasuminenManilasuurkaupungitosallistamineninformal housingcommunityparticipationtalonvaltausFilippiinitviranomaisetperheetasuntopolitiikkaprofessional squattersinformal settlersvalues formationköyhyyskansalaisjärjestöt
researchProduct

Formal property rights in the face of the substantial right to housing

2016

This paper explores the dichotomy between formal property rights and use value of rights in the field of the right to housing for homeless people, focusing on the entitlement of the squatting practices to claim the collective rights in the public domain. This collective claim can be considered an alternative to the ‘traditional’ conception of the public property as 'exclusive' domain of State. In the cities of Southern Europe, urban space has become an ‘object’ of contention by groups of inhabitants, who are organized at various levels, and an object of claiming – through illegal (although not illegitimate) forms of occupation of public or social private properties – the right to housing as…

capabilities approach right to housing squattingsquattingcapabilities approachright to housingSettore ICAR/21 - Urbanistica
researchProduct