Search results for "TIM"

showing 10 items of 25123 documents

¿Cómo afecta la innovación en la satisfacción y la lealtad hacia el establecimiento minorista?

2021

Resumen En el presente estudio, se examinó el concepto de innovación en el sector minorista y se definieron sus relaciones con otras variables, como la satisfacción y la lealtad, tradicionalmente vinculadas con el establecimiento minorista. Para lograr los objetivos planteados, se delimitó un modelo teórico sustentado en la literatura, que se contrastó mediante un estudio empírico utilizando un cuestionario estructurado ad hoc aplicado a una muestra de 510 clientes de establecimientos de alimentación. El análisis de los datos se desarrolló mediante la técnica de regresión por mínimos cuadrados parciales. Los resultados permiten proponer un conjunto de recomendaciones para la gestión, fundam…

//id.loc.gov/authorities/subjects/sh85078691 [http]HF5001-6182Strategy and ManagementSatisfaction//vocabularies.unesco.org/thesaurus/concept1545 [http]//vocabularies.unesco.org/thesaurus/concept4566 [http]LoyaltyConsumer protectionAdvertisingManagement of Technology and InnovationCambio tecnológicosatisfaçãoBusinessInnovación de marketing//vocabularies.unesco.org/thesaurus/concept6424 [http]MarketingLealtadM30 Generalrelational innovationConductainovação de marketinginnovación de marketingInnovaciones tecnológicasmarketing innovationproduct innovationinovação de produtoInnovación en productoTime to market (New products)Viral marketingEconomics and EconometricsConductlealdade//id.loc.gov/authorities/subjects/sh2003011474 [.http]PublicidadSistema de valoresinovação relacional//vocabularies.unesco.org/thesaurus/concept1532 [http]Innovación relacionalinnovación relacionalNormas de conductainnovación en producto//vocabularies.unesco.org/thesaurus/concept403 [http]SatisfacciónMercadeoProtección del consumidorValue systemsBusiness and International ManagementlealtadMercadeo viral//id.loc.gov/authorities/subjects/sh85133143 [http]Technological changeStandards of ConductsatisfacciónTiempo en el mercado (Productos nuevos)//id.loc.gov/authorities/subjects/sh85117681 [http]//id.loc.gov/authorities/subjects/sh94006567 [http]Technological innovationsFinance
researchProduct

Due note etimologiche circostanziali circa il Ms.II.D.54 (BNN) attribuito a Baffi

2019

Within the investigations on the attribution of some manuscripts to the famous philologist P. Baffi and now kept at the National Library of Naples (BNN), this brief contribution investigates in detail some of the passages contained in Ms.II.D.54 (f. 234r et f. 325r), in order to understand its meaning and to evaluate and validate its attributing hypotheses.

//pages.uv.es/SPhV/cas/numero21.wiki [Etymological notes ? Baffi ? Ms.II.D.54 (BNN) 5 21 https]UNESCO::CIENCIAS DE LAS ARTES Y LAS LETRASin order to understand its meaning and to evaluate and validate its attributing hypotheses. Note etimologiche ? Baffi ? Ms.II.D.54 (BNN)this brief contribution investigates in detail some of the passages contained in Ms.II.D.54 (f. 234r et f. 325r):CIENCIAS DE LAS ARTES Y LAS LETRAS [UNESCO]Nikola Within the investigations on the attribution of some manuscripts to the famous philologist P. Baffi and now kept at the National Library of Naples (BNN)Etymological notes ? Baffi ? Ms.II.D.54 (BNN) 5 21 https://pages.uv.es/SPhV/cas/numero21.wiki1135-9560 8276 Studia philologica valentina 536436 2019 21 7225810 Due note etimologiche circostanziali circa il Ms.II.D.54 (BNN) attribuito a Baffi Bellucci
researchProduct

Dynamical learning of a photonics quantum-state engineering process

2021

Abstract. Experimental engineering of high-dimensional quantum states is a crucial task for several quantum information protocols. However, a high degree of precision in the characterization of the noisy experimental apparatus is required to apply existing quantum-state engineering protocols. This is often lacking in practical scenarios, affecting the quality of the engineered states. We implement, experimentally, an automated adaptive optimization protocol to engineer photonic orbital angular momentum (OAM) states. The protocol, given a target output state, performs an online estimation of the quality of the currently produced states, relying on output measurement statistics, and determine…

/dk/atira/pure/subjectarea/asjc/2200/2204/dk/atira/pure/subjectarea/asjc/2500/2504Biomedical EngineeringphotonicsFOS: Physical sciencesquantum mechanicSettore FIS/03 - Fisica Della MateriaQuantum walkquantum informationquantum state engineeringqunatum informationblack-box optimizationQuantum Physicsquantum information; orbital angular momentum; black-box optimization; quantum state engineering; photonics/dk/atira/pure/subjectarea/asjc/3100/3107Orbital angular momentumState engineeringGeneral MedicineAtomic and Molecular Physics and OpticsElectronic Optical and Magnetic MaterialsAlgorithmmachine learningorbital angular momentumBlack-box optimizationQuantum Physics (quant-ph)Optics (physics.optics)Physics - OpticsAdvanced Photonics
researchProduct

A comprehensive probabilistic analysis of approximate SIR‐type epidemiological models via full randomized discrete‐time Markov chain formulation with…

2020

Spanish Ministerio de Economia y Competitividad, Grant/Award Number: MTM2017-89664-P; Generalitat Valenciana, Grant/Award Number: APOSTD/2019/128; Ministerio de Economia y Competitividad, Grant/Award Number: MTM2017-89664-P

010101 applied mathematicsDiscrete mathematicsMarkov chainDiscrete time and continuous timeGeneral Mathematics010102 general mathematicsGeneral EngineeringProbabilistic analysis of algorithms0101 mathematicsType (model theory)01 natural sciencesMathematicsMathematical Methods in the Applied Sciences
researchProduct

Constant sign and nodal solutions for nonlinear robin equations with locally defined source term

2020

We consider a parametric Robin problem driven by a nonlinear, nonhomogeneous differential operator which includes as special cases the p-Laplacian and the (p,q)-Laplacian. The source term is parametric and only locally defined (that is, in a neighborhood of zero). Using suitable cut-off techniques together with variational tools and comparison principles, we show that for all big values of the parameter, the problem has at least three nontrivial smooth solutions, all with sign information (positive, negative and nodal).

010102 general mathematicsMathematical analysisMathematics::Spectral Theory01 natural sciencesLocally defined reactionTerm (time)Critical groups010101 applied mathematicsNonlinear systemConstant sign and nodal solutionsSettore MAT/05 - Analisi MatematicaModeling and SimulationQA1-9390101 mathematicsNonlinear maximum principleConstant (mathematics)NODALMathematicsAnalysisSign (mathematics)MathematicsNonlinear regularity
researchProduct

Removing the saturation assumption in Bank-Weiser error estimator analysis in dimension three

2020

International audience; We provide a new argument proving the reliability of the Bank-Weiser estimator for Lagrange piecewise linear finite elements in both dimension two and three. The extension to dimension three constitutes the main novelty of our study. In addition, we present a numerical comparison of the Bank-Weiser and residual estimators for a three-dimensional test case.

010103 numerical & computational mathematicsResidual01 natural sciencesPiecewise linear function: Multidisciplinaire généralités & autres [C99] [Ingénierie informatique & technologie]Dimension (vector space)Bank-Weiser estimatorApplied mathematicsfinite element methodssaturation assumption0101 mathematicsReliability (statistics)Mathematicsresidual estimatorBank-WeiserestimatorApplied Mathematics: Multidisciplinary general & others [C99] [Engineering computing & technology]NoveltyEstimatorExtension (predicate logic)16. Peace & justiceFinite element methoda posteriori error estimation010101 applied mathematics: Mathematics [G03] [Physical chemical mathematical & earth Sciences]: Mathématiques [G03] [Physique chimie mathématiques & sciences de la terre][MATH.MATH-NA]Mathematics [math]/Numerical Analysis [math.NA]
researchProduct

Analytical description of solid particles kinematics due to a fluid flow and application to the depiction of characteristic kinematics in cold sprayi…

2017

Abstract In several multiphase flow applications such as fluidization, thermal spraying, atomization manufacturing and so on, the Newton's law is widely enacted to formulate the particle/fluid kinematic interaction and then to compute particles kinematics. This paper provides analytical solutions of the Newton's law in its time-dependent formulation or simplified formulation, the latter being a reduction of the time dependent problem into a spatial description of the particle motion. It was found that the velocity solution is strictly similar in both cases so that the simplified formulation is viable. The W_ 1 branch of the Lambert's function yields the analytical particle residence time an…

010302 applied physicsChemistryGeneral Chemical EngineeringMultiphase flow02 engineering and technologyMechanicsKinematics021001 nanoscience & nanotechnologyResidence time (fluid dynamics)01 natural sciencessymbols.namesakeMach number0103 physical sciencesFluid dynamicssymbolsParticleParticle velocity0210 nano-technologyMagnetosphere particle motionPowder Technology
researchProduct

Pulsed Electro-Acoustic Method for specimens and cables employed in HVDC systems: Some feasibility considerations

2018

Recent experiments on the use of the PEA method for testing dielectric materials in specimens and comparison with a detailed model provide an insight of the phenomenon and suggest the need of adopting similar models also for cables. What is said is even more important considering the possible future adoption of the PEA methodology to test DC cables for Pre-Qualification and Type Tests. The use of an accurate model of the PEA cell used for testing specimens and related experiments prove that the thickness of the different parts composing the PEA setup is a basic element for providing accurate charge reading and interpretation of the phenomenon. Both simulation and experimental results, carri…

010302 applied physicsControl and OptimizationComputer science020209 energySample (material)Issues in PEA measurementMechanical engineeringEnergy Engineering and Power Technology02 engineering and technologyAcoustic wave01 natural sciencesSettore ING-IND/33 - Sistemi Elettrici Per L'EnergiaSettore ING-IND/31 - ElettrotecnicaPulsed Electro-Acoustic methodComputer Networks and Communication0103 physical sciencesReflection phenomenon0202 electrical engineering electronic engineering information engineeringDC cableCharge accumulation
researchProduct

Conic optical fiber probe for generation and characterization of microbubbles in liquids

2021

Abstract A novel optical fiber probe has been developed to provide mechanical stability to microbubbles generated in fluids, the tip of the fiber is etched with hydrofluoric acid to pierce a truncated horn that fastens the microbubbles to the fiber tip and prevents misalignment or detachment caused by convection currents, vibrations or shocks in the liquid. Microbubbles are photo-thermally generated on the etched fiber and used as Fabry-Perot cavity sensor. Two methods were used to interrogate the probe: the first one, in the wavelength domain, is suitable for calibration in static or quasi static situations; the second one, in the time domain, can be used in dynamic environments. Experimen…

010302 applied physicsConvectionMaterials sciencebusiness.industryMetals and Alloys02 engineering and technology021001 nanoscience & nanotechnologyCondensed Matter Physics01 natural sciencesSurfaces Coatings and FilmsElectronic Optical and Magnetic MaterialsWavelengthOptics0103 physical sciencesMicrobubblesCalibrationFiberTime domainElectrical and Electronic Engineering0210 nano-technologybusinessInstrumentationQuasistatic processBar (unit)Sensors and Actuators A: Physical
researchProduct

A study of the optical effect of plasma sheath in a negative ion source using IBSIMU code

2020

A plasma sheath inside an ion source has a strong focusing effect on the formation of an ion beam from the plasma. Properties of the beam depend on the shape and location of the plasma sheath inside the source. The most accessible experimental data dependent on the plasma sheath are the beam phase space distribution. Variation of beam emittance is a reflection of the properties of the plasma sheath, with minimum emittance for the optimal shape of the plasma sheath. The location and shape of the plasma sheath are governed by complex physics and can be understood by simulations using plasma models in particle tracking codes like IBSimu. In the current study, a model of the D-Pace’s TRIUMF lic…

010302 applied physicsDebye sheathMaterials scienceIon beamPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesIon sourcenegative ion source010305 fluids & plasmassymbols.namesakeplasma sheathPhysics::Plasma Physics0103 physical sciencesPhysics::Space PhysicssymbolsPhysics::Accelerator PhysicsThermal emittanceStrong focusingBeam emittanceAtomic physicsInstrumentationBeam (structure)
researchProduct