Search results for "TIM"

showing 10 items of 25123 documents

Accumulation of positrons from a LINAC based source

2020

International audience; The GBAR experiment aims to measure the gravitational acceleration of antihydrogen H̅. It will use H̅+ ions formed by the interaction of antiprotons with a dense positronium cloud, which will require about 1010 positrons to produce one H̅+. We present the first results on the positron accumulation, reaching 3.8±0.4×108 e+ collected in 560 s.

010302 applied physicsPhysicsMeasure (physics)General Physics and Astronomy02 engineering and technology021001 nanoscience & nanotechnologyGravitational acceleration01 natural sciencesLinear particle acceleratorPositroniumNuclear physicsPositronPositron plasma; Positron accumulation; Antimatter; Penning-Malmberg trap; Greaves-Surko trap; GBAR[PHYS.QPHY]Physics [physics]/Quantum Physics [quant-ph]AntiprotonAntimatter0103 physical sciences[PHYS.HEXP]Physics [physics]/High Energy Physics - Experiment [hep-ex]Physics::Accelerator PhysicsPhysics::Atomic Physics0210 nano-technologyAntihydrogenComputingMilieux_MISCELLANEOUSActa Physica Polonica A
researchProduct

Multimode time-dependent gyrotron equations for different time scales

2017

The work of H.K. was supported by the European Regional Development Funding of the Project No. 1.1.1.1/ 16/A/004.

010302 applied physicsPhysicsMulti-mode optical fiberTransit timeElectronCondensed Matter Physics01 natural sciences010305 fluids & plasmaslaw.inventionFormalism (philosophy of mathematics)AmplitudelawGyrotronQuantum electrodynamicsQuantum mechanics0103 physical sciences:NATURAL SCIENCES:Physics [Research Subject Categories]Microwave
researchProduct

Measurements of the energy distribution of electrons lost from the minimum B-field -- the effect of instabilities and two-frequency heating

2020

Further progress in the development of ECR ion sources (ECRIS) requires deeper understanding of the underlying physics. One of the topics that remains obscure, though being crucial for the performance of the ECRIS, is the electron energy distribution (EED). A well-developed technique of measuring the EED of electrons escaping axially from the magnetically confined plasma of an ECRIS was used for the study of EED in unstable mode of plasma confinement, i.e. in the presence of kinetic instabilities. The experimental data were recorded for pulsed and CW discharges with a room-temperature 14 GHz ECRIS at the JYFL accelerator laboratory. The measurements were focused on observing differences bet…

010302 applied physicsPhysicsResonanceFOS: Physical sciencesPlasmaElectronhiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesPhysics - Plasma PhysicsElectron cyclotron resonanceIon source010305 fluids & plasmasMagnetic fieldIonPlasma Physics (physics.plasm-ph)Magnetic trap0103 physical sciencesAtomic physicsInstrumentation
researchProduct

Simulations on time-of-flight ERDA spectrometer performance

2016

The performance of a time-of-flight spectrometer consisting of two timing detectors and an ionization chamber energy detector has been studied using Monte Carlo simulations for the recoil creation and ion transport in the sample and detectors. The ionization chamber pulses have been calculated using Shockley-Ramo theorem and the pulse processing of a digitizing data acquisition setup has been modeled. Complete time-of-flight–energy histograms were simulated under realistic experimental conditions. The simulations were used to study instrumentation related effects in coincidence timing and position sensitivity, such as background in time-of-flight–energy histograms. Corresponding measurement…

010302 applied physicsPhysicsta114SpectrometerPhysics::Instrumentation and Detectorsbusiness.industryInstrumentationMonte Carlo methodDetector7. Clean energy01 natural sciencesMonte Carlo simulationsNuclear physicsTime of flightRecoilOpticsData acquisitiontime-of-flight spectrometers0103 physical sciencesIonization chambersimulations010306 general physicsbusinessInstrumentationReview of Scientific Instruments
researchProduct

THE GYROTRON STARTUP SCENARIO IN THE SINGLE MODE TIME DEPENDENT APPROACH

2019

The paper explains how to solve the Gyrotron equation system in the Single Mode Time Dependent Approach. In particular, we point out problems encountered when solving these well-known equations. The starting current estimation approach a using time model is suggested. The solution has been implemented in the Matlab code, which is attached to the article.

010302 applied physicsPhysicstime dependent approachgyrotronNuclear engineeringSingle-mode optical fiberMatlab code01 natural sciences010305 fluids & plasmaslaw.inventiondifferential equationlawModeling and SimulationGyrotron0103 physical sciencesQA1-939MathematicsAnalysisMathematical Modelling and Analysis
researchProduct

Fundamentals on the Molecular Mechanism of Action of Antimicrobial Peptides

2019

Abstract Antimicrobial peptides (AMPs) are produced by several organisms as their first line of defense. Constituted by amino acids, they may present different mechanisms of action. The antimicrobial activity can be used by the peptide-producing organism itself, as innate immune strategy, or in the industry, applying as natural source preservatives. Understanding the possibilities of the operation of these compounds is a prerequisite for the development of effective uses, as well as for the establishment of combinations, which can even expand their applications considering the possibilities of genetic manipulations. Thus, the objective of this article is to review the basic principles of AM…

010302 applied physicsPhysiological functionMaterials scienceInnate immune systemComputer scienceFirst lineAntimicrobial peptides02 engineering and technology021001 nanoscience & nanotechnologyAntimicrobial01 natural sciencesAction (philosophy)0103 physical sciencesNatural sourceMolecular mechanismGeneral Materials ScienceBiochemical engineering0210 nano-technologyOrganismSSRN Electronic Journal
researchProduct

Defect-induced blue luminescence of hexagonal boron nitride

2016

Abstract Native defect-induced photoluminescence around 400 nm (blue luminescence - BL) was studied in hBN materials with different size and various origins. The following spectral characterizations were used: spectra of luminescence and its excitation, luminescence dependence on temperature, luminescence kinetics, optically stimulated luminescence and infrared absorption. It was found, that the BL is characteristic for all these materials, which were studied. The BL forms a wide, asymmetric and phonon-assisted emission band at 380 nm. This luminescence can be excited either through the exciton processes, or with light from two defect-induced excitation bands at 340 nm and 265 nm. It was fo…

010302 applied physicsQuenching (fluorescence)Materials sciencePhotoluminescenceOptically stimulated luminescencebusiness.industryMechanical EngineeringExcitonInfrared spectroscopy02 engineering and technologyGeneral Chemistry021001 nanoscience & nanotechnologyPhotochemistry01 natural sciencesElectronic Optical and Magnetic MaterialsExcited stateVacancy defect0103 physical sciencesMaterials ChemistryOptoelectronicsElectrical and Electronic Engineering0210 nano-technologybusinessLuminescenceDiamond and Related Materials
researchProduct

Sub-nanosecond excitonic luminescence in ZnO:In nanocrystals

2019

The financial support of research European Union ERA.NET RUS_ST20170-51 . This work was partly supported by Russian Foundation for Basic Research, Russia , project No. 18-52-76002 . The sample preparation was carried out as part of SFERA II project -Transnational Access activities ( European Union 7th Framework Programme Grant Agreement N3126430 ).

010302 applied physicsRadiationMaterials scienceMorphology (linguistics)DopingKineticsAnalytical chemistrychemistry.chemical_elementTime-resolved luminescenceNanosecondVapour deposition01 natural sciences030218 nuclear medicine & medical imaging03 medical and health sciences0302 clinical medicineNanocrystalchemistry0103 physical sciences:NATURAL SCIENCES:Physics [Research Subject Categories]In [ZnO]Indium dopingLuminescenceInstrumentationScintillationIndium
researchProduct

Lead evaporation instabilities and failure mechanisms of the micro oven at the GTS-LHC ECR ion source at CERN

2020

The GTS-LHC ECR ion source (named after the Grenoble Test Source and the Large Hadron Collider) at CERN provides heavy ion beams for the chain of accelerators from Linac3 up to the LHC for high energy collision experiments and to the Super Proton Synchrotron for fixed target experiments. During the standard operation, the oven technique is used to evaporate lead into the source plasma to produce multiple charged lead ion beams. Intensity and stability are key parameters for the beam, and the operational experience is that some of the source instabilities can be linked to the oven performance. Over long operation periods of several weeks, the evaporation is not stable which makes the tuning …

010302 applied physicsRange (particle radiation)Large Hadron ColliderMaterials scienceionitNuclear engineeringEvaporationPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesSuper Proton SynchrotronIon source010305 fluids & plasmasIonComputer Science::OtherPhysics::Popular Physics0103 physical scienceslyijyInstrumentationBeam (structure)
researchProduct

Enhanced loss model algorithm for interior permanent magnet synchronous machines

2017

This paper presents an experimental study on the impact of the parameter variations over the performances of a LMA (Loss Model Algorithm) designed for an IPMSM (Interior Permanent Magnet Synchronous Machine). In a previous work, the characterization was carried out by assessing, for several working conditions, the motor parameters that influence the motor efficiency. The proposed enhanced loss model algorithm is implemented in a rapid prototyping system and its performances, in term of efficiency, are compared with other control systems, obtaining promising results.

010302 applied physicsRapid prototypingInterior permanent magnet synchronous motorComputer science020208 electrical & electronic engineeringWork (physics)02 engineering and technologySettore ING-IND/32 - Convertitori Macchine E Azionamenti Elettrici01 natural sciencesDC motorTerm (time)Settore ING-IND/31 - Elettrotecnicaspeed control drive systemsMagnetControl system0103 physical sciences0202 electrical engineering electronic engineering information engineeringTorquepower loss minimizationSettore ING-INF/07 - Misure Elettriche E ElettronicheAlgorithmPermanent magnet synchronous machine2017 AEIT International Annual Conference
researchProduct