Search results for "TIME"

showing 10 items of 12336 documents

Predicting species richness of wood-inhabiting fungi, epiphytic bryophytes and lichens based on stand structure and indicator species

2015

Maailmanlaajuinen monimuotoisuuden vähentyminen on ollut suuri huolenaihe jo useiden vuosikymmenten ajan. Lauhkeat lehtimetsät ovat yksi eniten ihmisen vaikutuksesta kärsineistä biomeista ja eteenkin vanhat, luonnontilaiset metsät ovat vähentyneet huolestuttavasti. Ilmaston ja maisemallisten tekijöiden lisäksi metsän historia, häiriödynamiikka, metsätalous ja ekologinen jatkuvuus vaikuttavat metsän rakenteelliseen monimuotoisuuteen ja näin ollen myös lajirunsauteen. Monet lajiryhmät ovat kuitenkin huonosti tunnettuja ja vaikeasti havaittavissa, eikä lopullisia syitä lajin häviämiseen alueelta pystytä varmasti sanomaan. Tutkimukseni tarkoitus oli selvittää, mitkä elementit metsän rakenteessa…

pienilmastodead woodpohjavesiisäntäkasvitconservationhost-tree diversitywater levellocal indicator speciesmetsätancient forest plant speciesstand agelehtimetsätputkilokasvitluonnonsuojelulahopuutmicroclimate
researchProduct

Strain effects in phosphorus bound exciton transitions in silicon

2023

Donor spin states in silicon are a promising candidate for quantum information processing. One possible donor spin readout mechanism is the bound exciton transition that can be excited optically and creates an electrical signal when it decays. This transition has been extensively studied in bulk, but in order to scale towards localized spin readout, microfabricated structures are needed for detection. As these electrodes will inevitably cause strain in the silicon lattice, it will be crucial to understand how strain affects the exciton transitions. Here we study the phosphorous donor bound exciton transitions in silicon using hybrid electro-optical readout with microfabricated electrodes. W…

piiCondensed Matter - Mesoscale and Nanoscale PhysicsPhysics and Astronomy (miscellaneous)Physics::Instrumentation and Detectorsdouppaus (puolijohdetekniikka)FOS: Physical sciencesoptoelektroniikkamikrorakenteetCondensed Matter::Materials Sciencefotoniikkapuolijohteetspin (kvanttimekaniikka)Mesoscale and Nanoscale Physics (cond-mat.mes-hall)General Materials Sciencekvantti-informaatiofosforiPhysical Review Materials
researchProduct

Educación artística : revista de investigación

2019

Resumen: En este artículo se presenta una experiencia artística realizada en diez centros de enseñanza secundaria de L’Horta Nord y Camp de Morvedre (València) sobre los procesos de construcción identitaria mediante actitudes artísticas contemporáneas, en este caso, a través del videoarte. Utilizando la Investigación educativa basada en las artes (Arts Based Educational Research) se ha llevado a término la realización y posterior análisis interpretativo de todas las producciones videográficas fundamentadas en el autorretrato tradicional, por tanto, han conformado unos resultados muy interesantes que inducen a reflexionar sobre la utilización y desarrollo de estos nuevos géneros contemporáne…

pinturamétodo multimediaUNESCO::CIENCIAS DE LAS ARTES Y LAS LETRASenseñanza secundariaSecondary educationmedia_common.quotation_subjectArtindividualidadThe artsarteinvestigaciónconcepto de sí mismo:CIENCIAS DE LAS ARTES Y LAS LETRAS [UNESCO]School environmentidentidadHumanitieseducación artísticamedia_common
researchProduct

Quasi-periodical kinetic instabilities in minimum-B confined plasma

2022

We present the results of an experimental investigation of quasi-periodical kinetic instabilities exhibited by magnetically confined electron cyclotron resonance heated plasmas. The instabilities were detected by measuring plasma microwave emission, electron losses, and wall bremsstrahlung. The instabilities were found to be grouped into fast sequences of periodic plasma losses, separated by ∼100 µs between the bursts, followed by 1–10 ms quiescent periods before the next event. Increasing the plasma energy content by adjusting the plasma heating parameters, in particular the magnetic field strength, makes the instabilities more chaotic in the time domain. Statistical analysis reveals that …

plasma confinemention sourcessyklotronitPhysicsQC1-999ECR-ionilähteetGeneral Physics and Astronomyplasma heatingplasma instabilitiescyclotron resonancehiukkaskiihdyttimetplasmafysiikkaAIP Advances
researchProduct

Characteristic Kα emission of electron cyclotron resonance ion source plasmas

2018

This thesis presents the results of an investigation of the volumetric Kα emission rate/inner shell ionization rate from an Electron Cyclotron Resonance Ion Source (ECRIS) plasma tuned predominantly for high charge state ion production. The experimental work include four complimentary studies covering the influence of a parametric sweep of the four source tune parameters i.e microwave power, neutral gas flow, biased disc voltage and magnetic field on the volumetric Kα emission rate, an investigation into the gas mixing effect, an investigation into the effectiveness of double-frequency heating mode and finally an investigation into microwave induced electron losses (relative and direct) from th…

plasma diagnosticsPhysics::Plasma Physicsplasma (kaasu)syklotronitelectron lossesvolumetric Kα emissionhiukkaskiihdyttimetplasmafysiikkaECRISemissio (fysiikka)
researchProduct

Effects of magnetic configuration on hot electrons in a minimum-B ECR plasma

2020

To investigate the hot electron population and the appearance of kinetic instabilities in highly charged electron cyclotron resonance ion source (ECRIS), the axially emitted bremsstrahlung spectra and microwave bursts emitted from ECRIS plasma were synchronously measured on SECRAL-II (Superconducting ECR ion source with Advanced design in Lanzhou No. II) ion source with various magnetic field configurations. The experimental results show that when the ratio of the minimum field to the resonance field (i.e. Bmin/Becr) is less than ~0.8, the bremsstrahlung spectral temperature Ts increases linearly with the Bmin/Becr–ratio when the injection, extraction and radial mirror fields are kept const…

plasma physicshiukkaskiihdyttimetplasmafysiikka
researchProduct

Data for "Plasmon excitations in chemically heterogeneous nanoarrays"

2020

The data includes atomic structures, photoabsorption spectra, and noninteracting spectra of the systems modeled in the article "Plasmon excitations in chemically heterogeneous nanoarrays" by Kevin Conley et al. See README.md in the archive for a detailed description.

plasmontime-dependent density-functional theory
researchProduct

Kohn-Sham Decomposition in Real-Time Time-Dependent Density-Functional Theory An Efficient Tool for Analyzing Plasmonic Excitations

2017

The real-time-propagation formulation of time-dependent density-functional theory (RT-TDDFT) is an efficient method for modeling the optical response of molecules and nanoparticles. Compared to the widely adopted linear-response TDDFT approaches based on, e.g., the Casida equations, RT-TDDFT appears, however, lacking efficient analysis methods. This applies in particular to a decomposition of the response in the basis of the underlying single-electron states. In this work, we overcome this limitation by developing an analysis method for obtaining the Kohn-Sham electron-hole decomposition in RT-TDDFT. We demonstrate the equivalence between the developed method and the Casida approach by a be…

plasmonic excitationsTheoretical computer scienceKohn-Sham decompositionComputer scienceta221Kohn–Sham equationsFOS: Physical sciencesPhysics::Optics02 engineering and technology01 natural sciencesPhysics - Chemical Physics0103 physical sciencesMesoscale and Nanoscale Physics (cond-mat.mes-hall)Decomposition (computer science)Physics::Atomic and Molecular ClustersStatistical physicsPhysical and Theoretical ChemistryPhysics::Chemical Physics010306 general physicsta116PlasmonEigenvalues and eigenvectorsChemical Physics (physics.chem-ph)Condensed Matter - Materials ScienceCondensed Matter - Mesoscale and Nanoscale Physicsta114tiheysfunktionaaliteoriaMaterials Science (cond-mat.mtrl-sci)Time-dependent density functional theory16. Peace & justice021001 nanoscience & nanotechnologyComputer Science ApplicationsplasmonitBenzene derivativesnanohiukkaset0210 nano-technologyJOURNAL OF CHEMICAL THEORY AND COMPUTATION
researchProduct

Leikin arviointivälineet PAGS, ToP ja TOES tarkasteltuna käsitteellisesti ICF-CY-luokituksen kautta

2009

Leikin arviointivälineet PAGS, ToP ja TOES tarkasteltuna käsitteellisesti ICF-CY – luokituksen kautta. Mattila Liisa. Jyväskylän yliopisto. Liikunta- ja terveystieteiden tiedekunta. Terveystieteiden laitos. 2009.42s. Asiantuntijalla on tärkeä olla riittävästi tietoa leikin arvioinnin tavoitteen kannalta oikean arviointivälineen valitsemiseksi. Lapsen osallistumista leikkiin voidaan arvioida luonnollisessa leikkitilanteessa, jolloin leikkijän, ympäristön ja leikin välinen dynaaminen vuorovaikutus voidaan huomioida. Tässä tutkimuksessa tarkasteltiin käsitteellisesti luonnollisen leikkitilanteen havainnoinnin välineitä Play assessment for group settings (PAGS), Test of Playfulness (ToP) ja Tes…

play assessmentleikkiarviointimenetelmätICF-CY [Avainkäsitteet]leikin arviointiICFToPTOESleikitPAGSparticipationluokituksetarviointilapsetosallistuminen
researchProduct

Drainage inlets efficiency and its impact on pluvial flooding hazard evaluation uncertainty

2014

Flooding events in urban areas occur quite frequently as a consequence of rain events of lower intensity than the design one, even in case of correct network dimensioning. Inlets are in those cases the critical nodes, and efficient drainage is only ensured when care is taken on their appropriate design and positioning within the pluvial flood-prone areas. Classical approach for design and position of these hydraulic structures can result in high level of uncertainty in defining properly risk levels in urban areas. Further, evaluation of flood hazard in urban areas is made even more difficult if one considers that pluvial flooding can be caused by storm events characterised by a low return t…

pluvial floodingsurface drainageinletefficiencySettore ICAR/02 - Costruzioni Idrauliche E Marittime E IdrologiaUrban flood drainage inlet pluvial flooding hazardpluvial flooding inlet efficiency surface drainage
researchProduct