Search results for "TIMI"

showing 10 items of 4651 documents

Data from: Low fitness at low latitudes: wintering in the tropics increases migratory delays and mortality rates in an Arctic breeding shorebird

2020

1. Evolutionary theories of seasonal migration generally assume that the costs of longer migrations are balanced by benefits at the non-breeding destinations. 2. We tested, and rejected, the null hypothesis of equal survival and timing of spring migration for High Arctic breeding sanderling Calidris alba using six and eight winter destinations between 55° N and 25° S, respectively. 3. Annual apparent survival was considerably lower for adult birds wintering in tropical West-Africa (Mauritania: 0.74 and Ghana: 0.75) than in three European sites (0.84, 0.84 and 0.87) and in subtropical Namibia (0.85). Moreover, compared with adults, second calendar-year sanderlings in the tropics, but not in …

solar geolocationtimingsite fidelitynutrient storage strategiesCalidris alba
researchProduct

Environmental factors modulating cold tolerance, gene expression and metabolism in Drosophila montana

2011

sopeutuminenseasonalitymahlakärpäsetympäristötekijätcold toleranceD. virilislisääntyminenmetabolomicsphenotypic plasticitytalvehtiminenakklimatisaatiokylmänkestävyysDrosophila montanagene expressionhyönteisetkylmyyslämpötilageeniekspressioaineenvaihduntavalovuorokausirytmi
researchProduct

LACTOBACILLI IN SOURDOUGH FERMENTATION: A REVIEW

2007

Sourdough technology is widely used; it is employed in bread making and for the production of cakes. Sourdough is characterized by a complex microbial ecosystem, mainly represented by lactic acid bacteria and yeasts, whose fermentation confers to the resulting bread its characteristic features such as palatability and high sensory quality. Investigation of the microbial composition of sourdough is relevant in order to determine the potential activities of sourdough microorganisms. This review focuses on the role of the most important group of sourdough fermenting bacteria that consists of lactobacilli; species that belong to the Lactobacillus genus are the main responsible of flavor develop…

sostanze antimicrobiche Lactobacillus impasti acidiSettore AGR/16 - Microbiologia Agraria
researchProduct

Numerical methods for a nonlinear impact model: A comparative study with closed-form corrections

2011

A physically based impact model-already known and exploited in the field of sound synthesis-is studied using both analytical tools and numerical simulations. It is shown that the Hamiltonian of a physical system composed of a mass impacting on a wall can be expressed analytically as a function of the mass velocity during contact. Moreover, an efficient and accurate approximation for the mass outbound velocity is presented, which allows to estimate the Hamiltonian at the end of the contact. Analytical results are then compared to numerical simulations obtained by discretizing the system with several numerical methods. It is shown that, for some regions of the parameter space, the trajectorie…

sound synthesis0209 industrial biotechnologyMathematical optimizationnumerical analysisaudio signal processingAcoustics and UltrasonicsDiscretizationComputer sciencePhysical system02 engineering and technologyParameter spaceEnergy conservationsymbols.namesake020901 industrial engineering & automation0202 electrical engineering electronic engineering information engineeringElectrical and Electronic EngineeringComputer simulationSettore INF/01 - Informaticasound synthesis; numerical analysis; audio signal processingNumerical analysisMathematical analysisphysics computing020207 software engineeringimpact modelingimpact soundsEnergy conservationNonlinear systemnumerical simulationsymbolsnonlinear dynamical systemHamiltonian (quantum mechanics)
researchProduct

The Industrial Applicability of PEA Space Charge Measurements, for Performance Optimization of HVDC Power Cables

2019

Cable manufacturing industries are constantly trying to improve the electrical performance of power cables. During the years, it was found that one of the most relevant degradation factors influencing the cable lifetime is the presence of space charge in the insulation layer. To detect the accumulated charge, the pulsed electro-acoustic (PEA) method is the most used technique. Despite the wide use of the PEA cell, several issues are still present. In particular, the PEA output signal is strongly disturbed by the acoustic waves reflections within the PEA cell. This causes the distortion of the output signal and therefore the misinterpretation of the charge profiles. This, in turn, may result…

space charge; PEA method; PEA cell model; IEEE Std 1732; space charge in cablespea methodControl and OptimizationMaterials science020209 energyAcousticsEnergy Engineering and Power Technology02 engineering and technologylcsh:Technology01 natural sciencesSignalpea cell modelieee std 1732Distortion0103 physical sciences0202 electrical engineering electronic engineering information engineeringspace charge in cablesElectrical and Electronic EngineeringEngineering (miscellaneous)010302 applied physicslcsh:TRenewable Energy Sustainability and the EnvironmentAttenuationHigh voltageAcoustic waveSpace chargePower (physics)Settore ING-IND/31 - ElettrotecnicaReflection (physics)space chargeEnergy (miscellaneous)Energies
researchProduct

Spatial Succession for Degradation of Solid Multicomponent Food Waste and Purification of Toxic Leachate with the Obtaining of Biohydrogen and Biomet…

2022

A huge amount of organic waste is generated annually around the globe. The main sources of solid and liquid organic waste are municipalities and canning and food industries. Most of it is disposed of in an environmentally unfriendly way since none of the modern recycling technologies can cope with such immense volumes of waste. Microbiological and biotechnological approaches are extremely promising for solving this environmental problem. Moreover, organic waste can serve as the substrate to obtain alternative energy, such as biohydrogen (H2) and biomethane (CH4). This work aimed to design and test new technology for the degradation of food waste, coupled with biohydrogen and biomethane prod…

spatial succession; environmental contamination; food waste; recycling; dark fermentation; methanogenesis; syntrophyTechnologyControl and Optimizationenvironmental contaminationRenewable Energy Sustainability and the EnvironmentTEnergy Engineering and Power Technologymethanogenesisrecyclingfood wastedark fermentationsyntrophyspatial successionElectrical and Electronic EngineeringEngineering (miscellaneous)Energy (miscellaneous)Energies
researchProduct

Cooperative spectrum sensing schemes for future dynamic spectrum access infrastructures

2016

spectrum sensingtehokkuusdecision/data fusioncooperative communicationsdynamic spectrum access (DSA)matemaattinen optimointitiedonsiirtononlinear optimizationlangaton tiedonsiirtoradioverkotoptimointiefficiencycognitive radio (CR)taajuusalueetkognitiivinen radiolangattomat verkot
researchProduct

Broncoscopia virtuale in pazienti con lesioni endobronchiali stenosanti. Ottimizzazione della tecnica con TC spirale monostrato

2004

PURPOSE: To describe an original protocol for single slice spiral Computed Tomography (CT) virtual bronchoscopy in the evaluation of patients with central airway stenoses and compare the results with fibreoptic bronchoscopy. MATERIALS AND METHODS: Ten patients (4 female and 6 male; age range 22-60 years; mean age 44 years) with endobronchial disease diagnosed by fibreoptic bronchoscopy (8 malignant tumours, 1 benign tumour and 1 fibroid stenosis) underwent virtual bronchoscopy with single slice spiral CT. A panoramic spiral CT scan of the whole chest was first obtained. Once the area of interest had been identified, a new contrast enhanced scan was performed, from bottom to top, with the fo…

spiral CTvirtual bronchoscopyprotocoloptimization
researchProduct

Tapahtuman sponsorointi : kannattava sijoitus vai "Kankkulan kaivo"? : case: Helsingin yleisurheilun EM-kisat 1994

1997

sponsorointimarkkinointimix
researchProduct

A multi-objective Pareto design approach for simultaneous control of thinning and springback in complex stamping operations.

2009

Abstract In sheet metal forming operations design, optimization problems have to be solved in order to reach optimal process conditions. In these problems, there are some crucial issues to be taken into account: - most of the problems are multi objective problems, generally characterized by conflicting objectives: the definition of proper parameters aimed to prevent both springback and fracture is a typical example of an optimization problem in sheet metal forming characterized by conflicting goals; - in an industrial environment a great interest would be focused on the availability of a cluster of possible optimal solutions instead of a single “almost optimal” solution. Taking into account…

springbacksheet metal stampingthinningmulti-objective optimisationresponse surface methodSettore ING-IND/16 - Tecnologie E Sistemi Di Lavorazione
researchProduct