Search results for "Tolerance"

showing 10 items of 956 documents

Acclimation capacity and rate change through life in the zooplankton Daphnia

2020

When a change in the environment occurs, organisms can maintain an optimal phenotypic state via plastic, reversible changes to their phenotypes. These adjustments, when occurring within a generation, are described as the process of acclimation. While acclimation has been studied for more than half a century, global environmental change has stimulated renewed interest in quantifying variation in the rate and capacity with which this process occurs, particularly among ectothermic organisms. Yet, despite the likely ecological importance of acclimation capacity and rate, how these traits change throughout life among members of the same species is largely unstudied. Here we investigate these rel…

reversible plasticitysopeutuminenakklimatisaatiolämmönsietoallometryvesikirputheat tolerancefenotyyppibody sizethermal toleranceympäristönmuutokset
researchProduct

Safety and Tolerance Evaluation of Milk Fat Globule Membrane-Enriched Infant Formulas: A Randomized Controlled Multicenter Non-Inferiority Trial in H…

2014

ObjectiveThis multicenter non-inferiority study evaluated the safety of infant formulas enriched with bovine milk fat globule membrane (MFGM) fractions.MethodsHealthy, full-term infants ( n = 119) age ≤14 days were randomized to standard infant formula (control), standard formula enriched with a lipid-rich MFGM fraction (MFGM-L), or standard formula enriched with a protein-rich MFGM fraction (MFGM-P). Primary outcome was mean weight gain per day from enrollment to age 4 months (non-inferiority margin: –3.0 g/day). Secondary (length, head circumference, tolerability, morbidity, adverse events) and exploratory (phospholipids, metabolic markers, immune markers) outcomes were also evaluated.Res…

safetymedicine.medical_specialtyinfant feedingbusiness.industrygrowthGeneral Engineeringlcsh:RJ1-570lcsh:PediatricsGastroenterologyPrimary outcomeTolerabilityStandard infant formulaformula toleranceInternal medicineMedicineNon inferiority trialGlobules of fatmedicine.symptombusinessAdverse effectMilk fat globuleWeight gainBiomedical engineeringOriginal Researchmilk fat globule membraneClinical Medicine Insights: Pediatrics
researchProduct

The Time-Varying Effect of Participatory Shift Scheduling on Working Hour Characteristics and Sickness Absence: Evidence from a Quasi-Experiment in H…

2022

Participatory shift scheduling for irregular working hours can influence shift schedules and sickness absence. We investigated the effects of using participatory shift scheduling and shift schedule evaluation tools on working hour characteristics and sickness absence. We utilized a panel data for 2015−2019 with 16,557 hospital employees (6143 in the intervention and 10,345 in the control group). Difference-in-differences regression with ward-level clustered standard errors was used to estimate the average treatment effect on the treated coefficients relative to timing of the intervention with 95% confidence intervals (CI). Using participatory scheduling tool increased long working hou…

self-rosteringworking hourstyöterveystyöhyvinvointiHealth Toxicology and MutagenesisPublic Health Environmental and Occupational Healthsickness absencesairauspoissaolotHospitalsPersonnel Hospitaltyöaikaself-rostering; shift schedule; sickness absence; working hoursosallistaminenvuorotyötyössäkäyntiWork Schedule Tolerancetyöntekijätshift scheduleHumansSick LeavesairauslomaInternational journal of environmental research and public health
researchProduct

Effective Practices in Mitigating Soil Erosion from Fields

2017

Soil erosion by water is a natural process that cannot be avoided. Soil erosion depends on many factors, and a distinction should be made between humanly unchangeable (e.g., rainfall) and modifiable (e.g., length of the field) soil erosion factors. Soil erosion has both on-site and off-site effects. Soil conservation tries to combine modifiable factors so as to maintain erosion in an area of interest to an acceptable level. Strategies to control soil erosion have to be adapted to the desired land use. Knowledge of soil loss tolerance, T, i.e., the maximum admissible erosion from a given field, allows technicians or farmers to establish whether soil conservation practices need to be applied …

soil erosion soil loss tolerance on-site and off-site erosion impacts soil conservation burned areas erosion modeling for soil conservationSoil biodiversityAgroforestrycomplex mixturesSoil managementNo-till farmingEnvironmental protectionSoil functionsSoil retrogression and degradationEnvironmental scienceSettore AGR/08 - Idraulica Agraria E Sistemazioni Idraulico-ForestaliDryland salinitySoil conservationSurface runoff
researchProduct

The evolution of temperature tolerance and invasiveness in a fluctuating thermal environment

2016

The consequences of the climate change on species are still uncertain, despite of intensive research. Currently, rising temperature is not the only concern, since the climate change scenarios also predict increases in the amount of disturbances, such as storms, floods, and thermal fluctuations. Disturbances have also been shown to affect species’ evolution, for example by selecting for traits that are advantageous in fluctuating environments but are also facilitating invasiveness. In this thesis, I study the consequences of evolving in a fluctuating thermal environment by utilizing bacterial microcosms. First I tested the effects of fluctuating vs. constant temperature on the evolution of t…

sopeutuminenluonnonvalintaevoluutiotemperature fluctuationadaptationilmastonmuutoksetinvasiondisturbed environmentbakteeritinvaasiolajittolerance curvelämpötilaexperimental evolutionvieraslajitkokeellinen evoluutiobacterialeviäminenympäristönmuutokset
researchProduct

Environmental factors modulating cold tolerance, gene expression and metabolism in Drosophila montana

2011

sopeutuminenseasonalitymahlakärpäsetympäristötekijätcold toleranceD. virilislisääntyminenmetabolomicsphenotypic plasticitytalvehtiminenakklimatisaatiokylmänkestävyysDrosophila montanagene expressionhyönteisetkylmyyslämpötilageeniekspressioaineenvaihduntavalovuorokausirytmi
researchProduct

Adaptation to stressful environments : invasion success of the Colorado potato beetle (Leptinotarsa decemlineata)

2018

Biological invasions, specifically human-induced dispersals, are one of the major threats to our biodiversity and are predicted to increase. Invasive pests provide an opportunity to study whether adaptation to human-induced environments could promote invasions to other human-induced environments. One major anthropogenic selection pressure is created by pesticides, and pests can be exposed to various pesticides in their native, as well as introduced, ranges. I investigated whether exposure to anthropogenic selection (i.e. insecticides and herbicides) and exposure to multiple anthropogenic stressors selects for higher stress tolerance. I also tested whether parental prolonged diapause or inse…

species invasionssopeutuminenstress tolerancekoloradonkuoriainentuhoeläimettorjunta-aineetadaptationherbisiditinsektisiditpest speciesinsecticide stresstuhohyönteisetherbicideprolonged diapausevieraslajitlepotilasietokyky
researchProduct

Overexpression of SAMDC1 gene in Arabidopsis thaliana increases expression of defense-related genes as well as resistance to Pseudomonas syringae and…

2014

It has been previously described that elevation of endogenous spermine levels in Arabidopsis could be achieved by transgenic overexpression of S-Adenosylmethionine decarboxylase (SAMDC) or Spermine synthase (SPMS). In both cases, spermine accumulation had an impact on the plant transcriptome, with up-regulation of a set of genes enriched in functional categories involved in defense-related processes against both biotic and abiotic stresses. In this work, the response of SAMDC1-overexpressing plants against bacterial and oomycete pathogens has been tested. The expression of several pathogen defense-related genes was induced in these plants as well as in wild type plants exposed to an exogeno…

sperminepolyaminesSperminePlant ScienceSAMDClcsh:Plant cultureMicrobiologychemistry.chemical_compoundbiotic stressJasmonateArabidopsisBotanyPseudomonas syringaePolyaminesArabidopsis thalianalcsh:SB1-1110Original Research ArticleJasmonateHyaloperonospora arabidopsidisbiologystress response and stress tolerancefungifood and beveragesBiotic stressbiology.organism_classificationjasmonatechemistrySpermine synthasebiology.proteinSpermineFrontiers in Plant Science
researchProduct

Drought Stress Study on Nicotiana tabacum L., “Baladi”, an In Vitro Experimental Model

2021

Crops drought tolerance is a trait of outmost importance for agriculture especially today when climate change is affecting more the production for food and feed. The scope of this article is to evaluate in vitro drought stress response of Nicotiana tabacum L., “Baladi”. The experiment was set up for four successive stages starting with in vitro seedling development, hypocotyl cultivation, three generations of micropropagation, pre-acclimatization and acclimatization. The effect of abscisic acid (ABA) and/or polyethylene-glycol 6000 (PEG) on tobacco hypocotyl caulogenesis and micropropagation were investigated. Superoxide-dismutases (SODs) and peroxidases (POXs) are more active and different…

superoxide-dismuthaseAgriculture (General)Nicotiana tabacumDrought toleranceperoxidasedroughtPlant SciencetobaccoAcclimatizationS1-972Hypocotylchemistry.chemical_compoundhypocotylsAbscisic acidbiologyfungifood and beveragesin vitrobiology.organism_classificationacclimatizationshootingHorticulturechemistryMicropropagationSeedlingShootAgronomy and Crop ScienceFood ScienceAgriculture
researchProduct

Editorial: Thymic Epithelial Cells: New Insights Into the Essential Driving Force of T-Cell Differentiation.

2021

thymic stromal cellsT-LymphocytesImmunologyThymus GlandBiology03 medical and health sciences0302 clinical medicinethymusmedicineImmunology and AllergyAnimalsHumansImmunodeficiency030304 developmental biologycentral tolerance0303 health sciencesCell DifferentiationEpithelial CellsRC581-607medicine.diseaseCell biologyEditorialT cell differentiationthymic epithelial cellsCentral toleranceImmunologic diseases. Allergyimmunodeficiency030215 immunologyFrontiers in immunology
researchProduct