Search results for "Ton"

showing 10 items of 26404 documents

Lead evaporation instabilities and failure mechanisms of the micro oven at the GTS-LHC ECR ion source at CERN

2020

The GTS-LHC ECR ion source (named after the Grenoble Test Source and the Large Hadron Collider) at CERN provides heavy ion beams for the chain of accelerators from Linac3 up to the LHC for high energy collision experiments and to the Super Proton Synchrotron for fixed target experiments. During the standard operation, the oven technique is used to evaporate lead into the source plasma to produce multiple charged lead ion beams. Intensity and stability are key parameters for the beam, and the operational experience is that some of the source instabilities can be linked to the oven performance. Over long operation periods of several weeks, the evaporation is not stable which makes the tuning …

010302 applied physicsRange (particle radiation)Large Hadron ColliderMaterials scienceionitNuclear engineeringEvaporationPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesSuper Proton SynchrotronIon source010305 fluids & plasmasIonComputer Science::OtherPhysics::Popular Physics0103 physical scienceslyijyInstrumentationBeam (structure)
researchProduct

Acoustic Wave Behavior in a Specimen Containing an Air Void Defect

2019

The PEA method is the most used technique for the space charge measurements. As is well known, this method uses pressure waves to detect the charges accumulated in solid dielectrics. Based on its working principle, the generated acoustic waves travel within PEA cell and the specimen under test in order to be finally detected by the piezoelectric sensor. For a multilayer specimen and, in particular, in case of different materials that make up the specimen, the acoustic wave reflection is inevitable. Considering that, in several cases, the reflected waves could be detected by the piezoelectric sensor before than the main signals, the PEA cell output profile could results distorted. Based on t…

010302 applied physicsVoid (astronomy)Materials sciencePiezoelectric sensorPEA method020209 energyAcousticsReflected wavesair void02 engineering and technologyAcoustic waveDielectric01 natural sciencesSpace chargeSpace chargeKaptonreflection phenomenonSettore ING-IND/31 - ElettrotecnicaMultilayer specimen0103 physical sciences0202 electrical engineering electronic engineering information engineering
researchProduct

Simulation of IQE tuning of individual cells for DC-balancing multijunction tandem cells

2016

In the present work, the performance of stacks of cells connected in series is examined at different levels of internal quantum efficiency (IQE). Incident photons, generated by employing the ASTM G173-03 data set, are accounted for individually as they interact with the stack of cells. The efficiencies of the devices studied are dependent upon the DC balance throughout the stack of cells. It is demonstrated that reducing the internal quantum efficiency of upper cells can lead to a better DC balance and thereby higher efficiency.

010302 applied physicsWork (thermodynamics)Materials sciencePhotonTandembusiness.industryMonte Carlo methodElectrical engineering02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesStack (abstract data type)0103 physical sciencesOptoelectronicsQuantum efficiencyPhotonics0210 nano-technologybusinessPhotonic crystal2016 IEEE 43rd Photovoltaic Specialists Conference (PVSC)
researchProduct

Simulations of the effect of the contact energy levels on a simple model of a hot carrier cell

2016

In the present work, the performance of a simplified model of a hot carrier cell is examined at different energy levels of carrier collection. Incident photons, Monte Carlo generated by employing the ASTM G173-03 data set, are accounted for individually as they interact with the cell. It is assumed that the carriers can be collected ultra-fast, thus avoiding considering hot carrier thermalisation effects. Although the model is preliminary and lacking some mechanisms of hot carrier cells, it has been demonstrated that the present approach to modelling hot carrier solar cells can be developed into fully working models. Some effects of the absorption energy levels in the valence band have been…

010302 applied physicsWork (thermodynamics)SIMPLE (dark matter experiment)PhotonMaterials sciencebusiness.industryMonte Carlo methodElectrical engineering02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesComputational physicsThermalisationEnergy absorbing0103 physical sciencesValence band0210 nano-technologybusinessEnergy (signal processing)2016 IEEE 43rd Photovoltaic Specialists Conference (PVSC)
researchProduct

Ab initio multi-reference perturbation theory calculations of the ground and low-lying electronic states of the KRb molecule

2016

The potential energy curves of the low-lying electronic states correlating up to the limit K(4p) + Rb(5s) of KRb molecule have been calculated using the multi-reference perturbation theory method at the CASSCF/ XMCQDPT2 level of theory without and with spin–orbit coupling. The calculated parameters of the ground X 1 R + state are in the best agreement among all previously performed ab initio calculations for the KRb molecule. The calculated vibrational intervals of the ground electronic term of the 39 K 85 Rb molecule describe the experiment with the accuracy within ±1 cm ?1 . The calculated intensities of the 2 1 R + (v 0 = 3, J 0 = 26) ? X 1 R + (v 00 = 0...24, J 00 = 25, 27) transitions …

010304 chemical physicsAb initiochemistry.chemical_elementOvertone bandSpin–orbit interactionCondensed Matter Physics01 natural sciencesBiochemistryMolecular physicsPotential energyDissociation (chemistry)Rubidiumsymbols.namesakeDipolechemistryFranck–Condon principle0103 physical sciences:ЕСТЕСТВЕННЫЕ И ТОЧНЫЕ НАУКИ::Физика [ЭБ БГУ]Physics::Atomic and Molecular ClusterssymbolsPhysics::Atomic PhysicsPhysics::Chemical PhysicsPhysical and Theoretical ChemistryAtomic physics010306 general physics
researchProduct

Communication: multireference equation of motion coupled cluster: a transform and diagonalize approach to electronic structure.

2014

The novel multireference equation-of-motion coupled-cluster (MREOM-CC) approaches provide versatile and accurate access to a large number of electronic states. The methods proceed by a sequence of many-body similarity transformations and a subsequent diagonalization of the transformed Hamiltonian over a compact subspace. The transformed Hamiltonian is a connected entity and preserves spin- and spatial symmetry properties of the original Hamiltonian, but is no longer Hermitean. The final diagonalization spaces are defined in terms of a complete active space (CAS) and limited excitations (1h, 1p, 2h, …) out of the CAS. The methods are invariant to rotations of orbitals within their respective…

010304 chemical physicsChemistryGeneral Physics and AstronomyEquations of motionElectronic structure010402 general chemistry7. Clean energy01 natural sciencesLinear subspace0104 chemical sciencessymbols.namesakeCoupled clusterAtomic orbitalQuantum mechanics0103 physical sciencessymbolsComplete active spacePhysical and Theoretical ChemistryHamiltonian (quantum mechanics)Subspace topologyThe Journal of chemical physics
researchProduct

Spin-orbit ZORA and four-component Dirac-Coulomb estimation of relativistic corrections to isotropic nuclear shieldings and chemical shifts of noble …

2015

Hartree-Fock and density functional theory with the hybrid B3LYP and general gradient KT2 exchange-correlation functionals were used for nonrelativistic and relativistic nuclear magnetic shielding calculations of helium, neon, argon, krypton, and xenon dimers and free atoms. Relativistic corrections were calculated with the scalar and spin-orbit zeroth-order regular approximation Hamiltonian in combination with the large Slater-type basis set QZ4P as well as with the four-component Dirac-Coulomb Hamiltonian using Dyall's acv4z basis sets. The relativistic corrections to the nuclear magnetic shieldings and chemical shifts are combined with nonrelativistic coupled cluster singles and doubles …

010304 chemical physicsElectronic correlationChemical shiftNuclear TheoryKryptonchemistry.chemical_elementGeneral Chemistry010402 general chemistry01 natural sciences0104 chemical sciencesComputational Mathematicssymbols.namesakeNeonCoupled clusterchemistry0103 physical sciencesPhysics::Atomic and Molecular ClusterssymbolsDensity functional theoryAtomic physicsHamiltonian (quantum mechanics)Basis setJournal of Computational Chemistry
researchProduct

pKa at Quartz/Electrolyte Interfaces.

2016

Acidity of silanol sites at the crystalline quartz/aqueous electrolyte (NaCl, NaI, KCl) interfaces are calculated from ab initio molecular dynamics simulations. pKa’s are found to follow a combination of the cationic and anionic Hofmeister series in the order pKa(neat solution) < pKa(NaCl) < pKa(NaI) < pKa(KCl), in agreement with experimental measurements. Rationalization of this ranking is achieved in terms of the microscopic local solvation of the protonated silanols and their conjugated bases, the silanolates SiO–. The change in the pKa is the result of both water destructuring by alkali halides, as well as of the specific cation/SiO– interaction, depending on the electrolyte. M…

010304 chemical physicsHofmeister series[SDV]Life Sciences [q-bio]Inorganic chemistrySolvationCationic polymerizationHalideProtonation02 engineering and technologyElectrolyte021001 nanoscience & nanotechnologyAlkali metal01 natural sciencesSilanolchemistry.chemical_compoundchemistry0103 physical sciencesGeneral Materials Science[PHYS.PHYS.PHYS-CHEM-PH]Physics [physics]/Physics [physics]/Chemical Physics [physics.chem-ph]Physical and Theoretical Chemistry0210 nano-technologyThe journal of physical chemistry letters
researchProduct

Time-resolved photoisomerization of 1,1′-di-tert-butylstilbene and 1,1′-dicyanostilbene

2016

Abstract Photoisomerization of 1,1′-di-tert-butylstilbene ( 3 ) and 1,1′-dicyanostilbene ( 4 ) is monitored with stationary and broadband transient absorption spectroscopy. The electron affinity of the substituents correlates with the shift of the absorption band. The weak extinction of 3 complicates data interpretation, but comparison with earlier measured 1,1′-dimethylstilbene ( 1 ) and 1,1′-diethylstilbene ( 2 ) helps to assign transient spectra and relaxation paths. For 3 a long-lived perpendicular state P is observed with lifetime τ P  = 134 ps in acetonitrile. For 4 τ P  = 2.1 ps in acetonitrile and 27 ps in n-hexane, the difference indicating a substantial dipole moment (∼3D) of the …

010304 chemical physicsPhotoisomerizationChemistryRelaxation (NMR)Analytical chemistryGeneral Physics and Astronomy010402 general chemistry01 natural sciences0104 chemical sciencesDipolechemistry.chemical_compoundAbsorption bandElectron affinity0103 physical sciencesUltrafast laser spectroscopyPhysical and Theoretical ChemistrySpectroscopyAcetonitrileChemical Physics Letters
researchProduct

Dynamics of the excited-state hydrogen transfer in a (dG)·(dC) homopolymer: intrinsic photostability of DNA

2018

Multiscale molecular dynamics simulations reveal out-of-plane distortions that favour DNA photostability. A novel photostability mechanism involving four proton transfers and triggered by a nearby Na+ ion is also unveiled.

010304 chemical physicsProtonChemistryBase pairGuanineGeneral ChemistryHydrogen atom010402 general chemistry01 natural sciences0104 chemical sciencesNucleobase[CHIM.THEO]Chemical Sciences/Theoretical and/or physical chemistrychemistry.chemical_compoundChemistryChemical physicsExcited state0103 physical sciencesMolecule[CHIM]Chemical SciencesGround stateComputingMilieux_MISCELLANEOUS
researchProduct