Search results for "UK"

showing 10 items of 16131 documents

Latvijas Vēstures Institūta Žurnāls. 2012, Nr. 2 (83)

2012

Valsts pētījuma programma "Nacionālā identitāte: valoda, Latvijas vēsture, kultūra un cilvēkdrošība"

"Bērnu arheoloģija" un Latvijas arheoloģiskā materiāla izmantošana:HUMANITIES and RELIGION::History and philosophy subjects::Archaeology subjects [Research Subject Categories]:HUMANITIES and RELIGION::History and philosophy subjects::History subjects [Research Subject Categories]RecenzijasV. Grīna vadītās ASV misijas darbība Latvijā 1919. gadāThe Sources on the Early Modern Livonia in the Polish Crown Chancery BooksZinātnes dzīveVēstures avotiLielo kapu rekonstrukcijas piemērsPersonālijas
researchProduct

Zum Akademiestreit als eine Stufe auf dem Weg des Künstlers in sich selbst. Carl Hauptmanns "Einhart der Lächler"

2016

W powieści „Einhart der Lächler“ Carl Hauptmann opisuje drogę życiową artysty, która okazuje się poszukiwaniem własnej tożsamości. Carl Hauptmann ubiera swą opowieść w popularną formę powieści edukacyjnej. Droga Einharta prowadzi przez instytucje sztuki, wówczas napiętnowane przez konflikt pomiędzy wykształceniem akademickim artysty a jego kreatywną wolnością. Poniższy tekst koncentruje się na osadzeniu tego napięcia w ramach historycznych. W dalszej części przedstawione zostaną powiązania głównego bohatera z zaprzyjaźnionym z Carlem Hauptmannem malarzem – Otto Muellerem.

"Einhart der Lächler”Akademia Sztuk Pięknych we WrocławiucyganeriaAkademia Sztuk Pięknychexpressionismartist"Einhart der Lächler"Carl HauptmannBohemiaartystaOtto Muellerthe Academy of Fine Arts in WroclawekspresjonizmAcademy of Fine Arts
researchProduct

Kulinaria w przestrzeni miasta : nowe trendy, nowe potrzeby mieszkańców

2015

The subject of this article is culinary trends observable in Polish cities during the past few years. They include both the rediscovered practices, directly related to the cultural (culinary) heritage of a particular area, and these which have become popular only recently. According to the author, characteristic culinary fads are: the promotion of local delicacies on a large scale, growing interest in shopping in farmers’ markets offering organic produce (bio-markets) and traditional goods, growing popularity of street food (including street food festivals and picnics), and organizing the so called “breakfast on the grass” events.

"śniadanie na trawie"citykulinariastreet foodculinaryprodukty tradycyjne“breakfast on the grass”traditional productsmiastoStudia Etnologiczne i Antropologiczne
researchProduct

The Greenland shark Somniosus microcephalus—Hemoglobins and ligand-binding properties

2017

A large amount of data is currently available on the adaptive mechanisms of polar bony fish hemoglobins, but structural information on those of cartilaginous species is scarce. This study presents the first characterisation of the hemoglobin system of one of the longest-living vertebrate species (392 +/- 120 years), the Arctic shark Somniosus microcephalus. Three major hemoglobins are found in its red blood cells and are made of two copies of the same a globin combined with two copies of three very similar beta subunits. The three hemoglobins show very similar oxygenation and carbonylation properties, which are unaffected by urea, a very important compound in marine elasmobranch physiology.…

---0301 basic medicinegenetic structuresProtein ConformationGreenlandlcsh:MedicineRESONANCE RAMAN-SPECTRAHETERODONTUS-PORTUSJACKSONISpectrum Analysis RamanBiochemistrychemistry.chemical_compoundHemoglobinsProtein structureAMINO-ACID SEQUENCEAnimal CellsSequence Analysis ProteinRed Blood CellsUreaNOTOTHENIOID FISHESPost-Translational Modificationlcsh:ScienceHemeChondrichthyesMultidisciplinarybiologyChemistryOrganic CompoundsChemical ReactionsVertebrateEukaryotaMOLECULAR ADAPTATIONSMicrocephalusGlobinsChemistryBiochemistryOptical EquipmentVertebratesPhysical SciencesEngineering and TechnologyCellular TypesResearch ArticleEnvironmental MonitoringProtein BindingQUATERNARY STRUCTURESAllosteric regulationEquipmentSTRETCHING FREQUENCIESHeme03 medical and health sciencesOXYGEN-BINDINGbiology.animalAnimals14. Life underwaterGlobinHemoglobinPhotolysisBlood Cells030102 biochemistry & molecular biologyLaserslcsh:ROrganic ChemistryOrganismsChemical CompoundsBiology and Life SciencesProteinsxxxCell Biologybiology.organism_classificationCARTILAGINOUS FISHOxygen030104 developmental biologySomniosusFishSharkslcsh:QHemoglobinProtein MultimerizationELASMOBRANCH HEMOGLOBINElasmobranchiiPLoS ONE
researchProduct

Cryo-EM structure of ssDNA bacteriophage ΦCjT23 provides insight into early virus evolution.

2022

AbstractThe origin of viruses remains an open question. While lack of detectable sequence similarity hampers the analysis of distantly related viruses, structural biology investigations of conserved capsid protein structures facilitate the study of distant evolutionary relationships. Here we characterize the lipid-containing ssDNA temperate bacteriophage ΦCjT23, which infects Flavobacterium sp. (Bacteroidetes). We report ΦCjT23-like sequences in the genome of strains belonging to several Flavobacterium species. The virion structure determined by cryogenic electron microscopy reveals similarities to members of the viral kingdom Bamfordvirae that currently consists solely of dsDNA viruses wit…

/631/326/1321bacteriophagesviruksetcryoelectron microscopyevoluutioGeneral Physics and AstronomyelektronimikroskopiaDNA Single-Stranded/45/23FlavobacteriumGeneral Biochemistry Genetics and Molecular Biologybakteriofagit/631/45/535/1258/1259viral evolution/631/326/596/2554BacteriophagesMultidisciplinaryfylogenia/45fylogenetiikkaCryoelectron Microscopy/101/28articleGeneral Chemistryperimä1182 Biochemistry cell and molecular biologyCapsid Proteins
researchProduct

A study of the optical effect of plasma sheath in a negative ion source using IBSIMU code

2020

A plasma sheath inside an ion source has a strong focusing effect on the formation of an ion beam from the plasma. Properties of the beam depend on the shape and location of the plasma sheath inside the source. The most accessible experimental data dependent on the plasma sheath are the beam phase space distribution. Variation of beam emittance is a reflection of the properties of the plasma sheath, with minimum emittance for the optimal shape of the plasma sheath. The location and shape of the plasma sheath are governed by complex physics and can be understood by simulations using plasma models in particle tracking codes like IBSimu. In the current study, a model of the D-Pace’s TRIUMF lic…

010302 applied physicsDebye sheathMaterials scienceIon beamPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesIon sourcenegative ion source010305 fluids & plasmassymbols.namesakeplasma sheathPhysics::Plasma Physics0103 physical sciencesPhysics::Space PhysicssymbolsPhysics::Accelerator PhysicsThermal emittanceStrong focusingBeam emittanceAtomic physicsInstrumentationBeam (structure)
researchProduct

A new 18 GHz room temperature electron cyclotron resonance ion source for highly charged ion beams

2020

An innovative 18 GHz HIISI (Heavy Ion Ion Source Injector) room temperature Electron Cyclotron Resonance (ECR) ion source (ECRIS) has been designed and constructed at the Department of Physics, University of Jyväskylä (JYFL), for the nuclear physics program of the JYFL Accelerator Laboratory. The primary objective of HIISI is to increase the intensities of medium charge states (M/Q ≅ 5) by a factor of 10 in comparison with the JYFL 14 GHz ECRIS and to increase the maximum usable xenon charge state from 35+ to 44+ to serve the space electronics irradiation testing program. HIISI is equipped with a refrigerated permanent magnet hexapole and a noncylindrical plasma chamber to achieve very stro…

010302 applied physicsMaterials scienceIon beamsyklotronittutkimuslaitteetHighly charged ionchemistry.chemical_elementhiukkaskiihdyttimet01 natural sciences7. Clean energyIon sourceElectron cyclotron resonance010305 fluids & plasmasIonXenonchemistry0103 physical sciencesIrradiationAtomic physicsInstrumentationBeam (structure)
researchProduct

Mechanisms of Electron-Induced Single-Event Upsets in Medical and Experimental Linacs

2018

In this paper, we perform an in-depth analysis of the single-event effects observed during testing at medical electron linacs and an experimental high-energy electron linac. For electron irradiations, the medical linacs are most commonly used due to their availability and flexibility. Whereas previous efforts were made to characterize the cross sections at higher energies, where the nuclear interaction cross section is higher, the focus of this paper is on the complete overview of relevant electron energies. Irradiations at an electron linac were made with two different devices, with a large difference in feature size. The irradiations at an experimental linac were performed with varying en…

010302 applied physicsNuclear and High Energy PhysicsMaterials scienceta114010308 nuclear & particles physicselectronsElectron linacElectronhiukkaskiihdyttimetelektronitparticle accelerators01 natural sciencesLinear particle acceleratorNuclear physicsNuclear interactionradiation physicsCross section (physics)säteilyfysiikkaNuclear Energy and Engineering0103 physical sciencesElectrical and Electronic EngineeringEvent (particle physics)IEEE Transactions on Nuclear Science
researchProduct

Measurements of the energy distribution of electrons lost from the minimum B-field -- the effect of instabilities and two-frequency heating

2020

Further progress in the development of ECR ion sources (ECRIS) requires deeper understanding of the underlying physics. One of the topics that remains obscure, though being crucial for the performance of the ECRIS, is the electron energy distribution (EED). A well-developed technique of measuring the EED of electrons escaping axially from the magnetically confined plasma of an ECRIS was used for the study of EED in unstable mode of plasma confinement, i.e. in the presence of kinetic instabilities. The experimental data were recorded for pulsed and CW discharges with a room-temperature 14 GHz ECRIS at the JYFL accelerator laboratory. The measurements were focused on observing differences bet…

010302 applied physicsPhysicsResonanceFOS: Physical sciencesPlasmaElectronhiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesPhysics - Plasma PhysicsElectron cyclotron resonanceIon source010305 fluids & plasmasMagnetic fieldIonPlasma Physics (physics.plasm-ph)Magnetic trap0103 physical sciencesAtomic physicsInstrumentation
researchProduct

Lead evaporation instabilities and failure mechanisms of the micro oven at the GTS-LHC ECR ion source at CERN

2020

The GTS-LHC ECR ion source (named after the Grenoble Test Source and the Large Hadron Collider) at CERN provides heavy ion beams for the chain of accelerators from Linac3 up to the LHC for high energy collision experiments and to the Super Proton Synchrotron for fixed target experiments. During the standard operation, the oven technique is used to evaporate lead into the source plasma to produce multiple charged lead ion beams. Intensity and stability are key parameters for the beam, and the operational experience is that some of the source instabilities can be linked to the oven performance. Over long operation periods of several weeks, the evaporation is not stable which makes the tuning …

010302 applied physicsRange (particle radiation)Large Hadron ColliderMaterials scienceionitNuclear engineeringEvaporationPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesSuper Proton SynchrotronIon source010305 fluids & plasmasIonComputer Science::OtherPhysics::Popular Physics0103 physical scienceslyijyInstrumentationBeam (structure)
researchProduct