Search results for "YKI"

showing 10 items of 414 documents

Effect of Pseudomonas sp. MT5 baths on Flavobacterium columnare infection of rainbow trout and on microbial diversity on fish skin and gills

2005

Use of Pseudomonas sp. strain MT5 to prevent and treat Flavobacterium columnare infection was studied in 2 experiments with fingerling rainbow trout Oncorhynchus mykiss. In the first experiment, length heterogeneity analysis of PCR-amplified DNA fragments (LH-PCR) was used to assess the effect of antagonistic baths on the microbial diversity of healthy and experimentally infected fish. In the 148 samples studied, no difference was found between bathed and unbathed fish, and 3 fragment lengths were detected most frequently: 500 (in 75.7% of the samples), 523 (62.2%) and 517 bp (40.5%). The species contributing to these fragment sizes were Pseudomonas sp., Rhodococcus sp. and F. columnare, re…

GillsFish mortalityGillMolecular Sequence DataAquacultureAquatic ScienceFlavobacteriumPolymerase Chain ReactionColumnarisMicrobiologyFish DiseasesFlavobacteriaceae InfectionsPseudomonasImmersionEscherichia colimedicineAnimalsCloning MolecularEcology Evolution Behavior and SystematicsDNA PrimersSkinBase SequencebiologyPseudomonasSequence Analysis DNAbiology.organism_classificationmedicine.diseaseFlavobacteriaceaeElectroporationOncorhynchus mykissFlavobacterium columnareRainbow troutPseudomonadaceaeDiseases of Aquatic Organisms
researchProduct

Flavobacterium columnare colony types: connection to adhesion and virulence?

2008

Four different colony morphologies were produced by Flavobacterium columnare strains on Shieh agar plate cultures: rhizoid and flat (type 1), non-rhizoid and hard (type 2), round and soft (type 3), and irregularly shaped and soft (type 4). Colonies produced on AO agar differed from these to some extent. The colony types formed on Shieh agar were studied according to molecular characteristics [Amplified Fragment Length Polymorphism (AFLP), Automated Ribosomal Intergenic Spacer Analysis (ARISA), and whole cell protein SDS-PAGE profiles], virulence on rainbow trout fingerlings, and adhesion on polystyrene and fish gills. There were no molecular differences between colony types within one strai…

Gillsfood.ingredientRibosomal Intergenic Spacer analysisVirulenceBiologyMicrobiologyFlavobacteriumVirulence factorBacterial AdhesionMicrobiologyAgar plateFish DiseasesfoodBacterial ProteinsFlavobacteriaceae InfectionsDNA Ribosomal SpacerAgarAnimalsPhase variationVirulencebiology.organism_classificationCulture MediaAgarInfectious DiseasesOncorhynchus mykissFlavobacterium columnarePolystyrenesElectrophoresis Polyacrylamide GelFlavobacteriumPolymorphism Restriction Fragment LengthMicrobial pathogenesis
researchProduct

Inhibition of gluconeogenesis by extracellular ATP in isolated rat hepatocytes.

1991

The aim of this study was to determine the effect of externally added ATP on gluconeogenesis by isolated hepatocytes from starved rats. High concentrations of extracellular ATP inhibited gluconeogenesis from lactate and pyruvate but not from glycerol or fructose. This inhibition was associated with an increase in intracellular adenosine contents. ADP, AMP, or adenosine but not guanosine 5'triphosphate, inosine 5' triphosphate, or adenine also inhibited gluconeogenesis. alpha, beta-Methylene-ATP, a nonmetabolizable structural analogue of ATP, did not affect the rate of gluconeogenesis. Intracellular ATP levels were increased by externally added ATP or adenosine, but ATP-to-ADP ratios in the…

GlycerolMalePhysiologyFructoseBiologyAdenosine TriphosphateAdenine nucleotidePhysiology (medical)Pyruvic AcidmedicineExtracellularAnimalsGlycolysisLactic AcidPyruvatesChemiosmosisGluconeogenesisRats Inbred StrainsMetabolismAdenosineRatsAdenosine DiphosphateBiochemistryGluconeogenesisLiverLactatesPhosphoenolpyruvate carboxykinasemedicine.drugThe American journal of physiology
researchProduct

Kocioł Ezechiela (Ez 24,1-14) w świetle retoryki hebrajskiej

2021

Kontekstem badań było to, że niektórzy komentatorzy proponują różne struktury badanego tekstu. Celem badań stało się opracowanie struktury, którą zamieścił w tekście starożytny autor natchniony. Do tego posłużyła metoda retoryki hebrajskiej, którą opracował Roland Meynet. Udało się odkryć strukturę badanego tekstu. Jest to konstrukcja paralelna o schemacie: A (w. 1a) – B (w. 4ab) – C (w. 6b) – C’ (w. 9b) – B’ (w. 11abc) – A’ (w. 14a). Wnioski: obraz Boga, jaki wyłania się z Księgi Ezechiela, to Bóg Wszechmogący. Bóg Izraela może wszystko uczynić, nawet Nabuchodonozora uczynić narzędziem karania zarówno Izraela, jak i Egiptu. Ponadto należy nadal prowadzić badania nad retoryką hebrajską w Ks…

Hebrew rhetorical methodEzechielEzekiel’s cauldronBook of EzekielKsięga EzechielaEzekielmetoda retoryki hebrajskiejstruktury paralelnekocioł Ezechielaparallel structuresScriptura Sacra
researchProduct

Dignity in relationships and existence in nursing homes’ cultures

2022

Introduction: Expressions of dignity as a clinical phenomenon in nursing homes as expressed by caregivers were investigated. A coherence could be detected between the concepts and phenomena of existence and dignity in relationships and caring culture as a context. A caring culture is interpreted by caregivers as the meaning-making of what is accepted or not in the ward culture. Background: The rationale for the connection between existence and dignity in relationships and caring culture is that suffering is a part of existence, as well as compassion in relieving suffering, and ontological interdependency. Aim: To describe different expressions of dignity in relationships and existence in co…

HermeneuticsExistentialismCaring culturedignity in relationshipsexistencehermeneuticsHälsovetenskaperethicsRespectNursing HomesexistentialIssues ethics and legal aspectsVDP::Medisinske Fag: 700::Klinisk medisinske fag: 750::Psykiatri barnepsykiatri: 757dignityHealth SciencesHumansVDP::Medisinske Fag: 700RelationshipsEmpathyNursing ethics
researchProduct

NewSQL Database Management System Compiler Errors : Effectiveness and Usefulness

2022

Modern database management is often faced with a high number of concurrent end-users, and the need for database distribution to ensure fault tolerance and high throughput. To flexibly address these challenges, many modern database management systems (DBMS) provide highly automated and effortless, i.e., highly usable database distribution, deployment, and maintenance. However, the usability considerations are yet to extend from the aforementioned DBMS features to query language compilers. In this study, based on participant answers (N = 157), we compare the error message qualities of four modern DBMSs (CockroachDB, SingleStore, NuoDB, and VoltDB) using one objective and three subjective metr…

Human-Computer InteractionSQLkäytettävyysihmisen ja tietokoneen vuorovaikutusviestitvirheettietokannatHuman Factors and ErgonomicskyselykieletComputer Science Applicationstietojärjestelmätkäyttäjätutkimus
researchProduct

Emotionally Neglected or Deviant? Treating Childhood Neuroses in Communist Hungary during the Early 1960s

2018

HungaryPsychoanalysiscultural historylääketiedehistorialapsuuskulttuurihistoriaUnkaripsychiatrysocial historypsykiatriamielenterveyspsykiatrinen hoitososiaalihistoriamedicine (science)ta615historyPsychologymental healthCommunism
researchProduct

Kawalerzysta, dowódca i wykładowca - szkic do biografii gen. bryg. Konstantego Druckiego-Lubeckiego (1893-1940)

2018

Celem przeprowadzonych badań było opracowanie rozszerzonego szkicu biograficznego księcia gen. bryg. Konstantego Druckiego-Lubeckiego. Dzięki zebranym dokumentom i materiałom ustalono najważniejsze fakty z życia generała, dotyczące jego pochodzenia, nauki w Cesarskim Aleksandrowskim Liceum (Lycee Imperial Alexandre) w Petersburgu, udziału w walkach o niepodległość Polski oraz kariery w kawalerii i szkolnictwie wojskowym II RP. Udostępnione przez bliskich księcia materiały, skonfrontowane ze źródłami urzędowymi i dostępnymi publikacjami, pozwoliły także na ustalenie dodatkowych okoliczności związanych z jego śmiercią z rąk NKWD w 1940 roku. Dokumenty te umożliwiły rekonstrukcję podejmowanych…

I Korpus PolskiPolish II CorpsPolish - Soviet warzbrodnia katyńskaBrig. Gen. Konstanty Drucki-LubeckiPolski Cmentarz Wojenny w Kijowie - BykowniHigher Military SchoolKatyń MassacreWyższa Szkoła WojskowacavalryPolish Military Cemetery in Kiev - BykivniaPolish September Campaign of 1939Polish - Lithuanian wargen. bryg. Konstanty Drucki-Lubeckikampania polska 1939 rokuWieki Stare i Nowe
researchProduct

Grouping facilitates avoidance of parasites by fish

2013

Background. Parasite distribution is often highly heterogeneous, and intensity of infection depends, among other things, on how well hosts can avoid areas with a high concentration of parasites. We studied the role of fish behaviour in avoiding microhabitats with a high infection risk using Oncorhynchus mykiss and cercariae of Diplostomum pseudospathaceum as a model. Spatial distribution of parasites in experimental tanks was highly heterogeneous. We hypothesized that fish in groups are better at recognizing a parasitized area and avoiding it than solitary fish. Methods. Number of fish, either solitary or in groups of 5, was recorded in different compartments of a shuttle tank where fish co…

Infection riskEntomologyParasite avoidanceDiplostomum pseudospathaceumTrematode InfectionsBiologyDiplostomum pseudospathaceumHost-Parasite InteractionsFish DiseasesHeterogeneous habitatEscape ReactionkirjolohiAvoidance LearningAnimalsParasite hostingLoisten välttäminenheterogeeninen habitaattiEcosystemBehavior AnimalEcologyResearchbiology.organism_classificationKalojen parveutuminenRainbow troutInfectious DiseasesParasitologyOncorhynchus mykissFish <Actinopterygii>ParasitologyTrematodaFish grouping
researchProduct

Interactions among co-infecting parasite species: a mechanism maintaining genetic variation in parasites?

2008

Individuals of free-living organisms are often infected simultaneously by a community of parasites. If the co-infecting parasites interact, then this can add significantly to the diversity of host genotype×parasite genotype interactions. However, interactions between parasite species are usually not examined considering potential variation in interactions between different strain combinations of co-infecting parasites. Here, we examined the importance of interactions between strains of fish eye flukes Diplostomum spathaceum and Diplostomum gasterostei on their infectivity in naive fish hosts. We assessed the infection success of strains of both species in single-strain exposures and in co-…

InfectivityGeneticsPolymorphism GeneticVirulenceGeneral Immunology and MicrobiologyVirulenceGeneral MedicineBiologybiology.organism_classificationFish eyeGeneral Biochemistry Genetics and Molecular BiologyHost-Parasite InteractionsSpecies SpecificityDiplostomum spathaceumOncorhynchus mykissGenetic variationGenotypeAnimalsParasite hostingTrematodaTrematodaGeneral Agricultural and Biological SciencesResearch ArticleGeneral Environmental ScienceProceedings of the Royal Society B: Biological Sciences
researchProduct