Search results for "Zigbee"

showing 10 items of 13 documents

Learning From Errors: Detecting Cross-Technology Interference in WiFi Networks

2018

In this paper, we show that inter-technology interference can be recognized using commodity WiFi devices by monitoring the statistics of receiver errors. Indeed, while for WiFi standard frames the error probability varies during the frame reception in different frame fields (PHY, MAC headers, and payloads) protected with heterogeneous coding, errors may appear randomly at any point during the time the demodulator is trying to receive an exogenous interfering signal. We thus detect and identify cross-technology interference on off-the-shelf WiFi cards by monitoring the sequence of receiver errors (bad PLCP, bad FCS, invalid headers, etc.) and propose two methods to recognize the source of in…

MonitoringComputer Networks and CommunicationsComputer scienceReal-time computingheterogeneous network050801 communication & media studies02 engineering and technologySpectrum managementZigBee0508 media and communicationsArtificial IntelligencePHY0202 electrical engineering electronic engineering information engineeringLong Term EvolutionDemodulationWireless fidelityHidden Markov modelsHidden Markov modelCross technology interferenceArtificial neural networkSettore ING-INF/03 - Telecomunicazioni05 social sciencesComputerSystemsOrganization_COMPUTER-COMMUNICATIONNETWORKScoexistenceunlicensed bands020206 networking & telecommunicationsThroughputLearning from errorsHardware and ArchitectureInterferenceCoding (social sciences)
researchProduct

Insecure Firmware and Wireless Technologies as “Achilles’ Heel” in Cybersecurity of Cyber-Physical Systems

2022

In this chapter, we analyze cybersecurity weaknesses in three use-cases of real-world cyber-physical systems: transportation (aviation), remote explosives and robotic weapons (fireworks pyrotechnics), and physical security (CCTV). The digitalization, interconnection, and IoT-nature of cyber-physical systems make them attractive targets. It is crucial to ensure that such systems are protected from cyber attacks, and therefore it is equally important to study and understand their major weaknesses. peerReviewed

sulautettu tietotekniikkacybersecurityprotocolsasejärjestelmätilmailucyber-physical systemsfirmwaretakaisinmallinnusvideo surveillanceesineiden internetCCTVkyberturvallisuushaavoittuvuusvulnerabilitieswireless pyrotechnicsremote firing systemsexploitsvalvontajärjestelmätreverse engineeringZigbeeprotokollatcritical infrastructureaviationRFinfrastruktuuritbinareADS-B
researchProduct

Cyber Security for Wireless Semantic (SCADA/DCS) Systems

2016

International audience; Supervisory Control and Data Acquisition and Distributed Control Systems named (SCADA/DCS) have played a key role in the design of modern power smart applications, particularly in the automatic management of real time energetic platforms. In this work, we present a semantic cyber security vulnerabilities add to classic one, with the use of semantic embedded application in smart devices in semantic wireless (SCADA/DCS) systems, focusing on the semantic attacks. In this work, we present a new security semantic wireless protocol as a secure communication support for these modern semantic wireless systems named (ZIGBEE/SOAP/SECURITY), obtained by the combination between …

Engineeringcomputer.internet_protocolSOAP0211 other engineering and technologies[ INFO.INFO-CR ] Computer Science [cs]/Cryptography and Security [cs.CR]02 engineering and technologyComputer securitycomputer.software_genre[INFO.INFO-CR]Computer Science [cs]/Cryptography and Security [cs.CR]Supervisory controlSecure communicationSCADAWireless Application ProtocolSemantic Wireless (SCADA/DCS)Wireless Security ProtocolProtocol (object-oriented programming)Semantic Cyber Security[INFO.INFO-CR] Computer Science [cs]/Cryptography and Security [cs.CR]021110 strategic defence & security studiesbusiness.industryComputerSystemsOrganization_COMPUTER-COMMUNICATIONNETWORKS021001 nanoscience & nanotechnology(ZIGBEE/SOAP/SECURITY) ProtocolControl and Systems EngineeringKey (cryptography)0210 nano-technologyDistributed control systembusinessSmart Energetic PlatformcomputerComputer network
researchProduct

A Software Defined Radio Platform Implementing a WiFi and ZigBee Receiver

2006

A successful attempt to design and implement a multi-standard compliant Basebnd Processor is here presented. By exploiting the potential of FPGA's reconfigurability, the received signal from RF stage have been processed in order to properly decode frames of IEEE 802.11 (WiFi) and IEEE 802.15.4 (ZigBee) protocols. both falling within the ISM band (centered at 2.45GHz). The experimental implementation carried out is a practical demonstration of the Software Defined Radio concept.

Software Defined Radio Reconfigurable Architecture FPGA Implementation 802.11 ZigBeeSettore ING-INF/01 - Elettronica
researchProduct

DEMO: Unconventional WiFi-ZigBee communications without gateways

2014

Nowadays, the overcrowding of ISM bands is becoming an evident limitation for the performance and widespread usage of 802.11 and 802.15.4 technologies. In this demo, we prove that it is possible to opportunistically exploit the inter-technology interference between 802.11 and 802.15.4 to build an unconventional low-rate communication channel and signalling protocol, devised to improve the performance of each contending technology. Differently from previous solutions, inter-technology communications do not require the deployment of a gateway with two network interfaces, but can be activated (when needed) directly between two heterogeneous nodes, e.g. a WiFi node and a ZigBee node. This capab…

Exploitbusiness.industryComputer scienceSettore ING-INF/03 - TelecomunicazioniReading (computer)Node (networking)WiFiComputerSystemsOrganization_COMPUTER-COMMUNICATIONNETWORKSNetwork interfacezigbeeEmbedded systemDefault gatewayComputerSystemsOrganization_SPECIAL-PURPOSEANDAPPLICATION-BASEDSYSTEMSbusinessProtocol (object-oriented programming)Computer networkNeuRFonCommunication channel
researchProduct

An Inter-Technology Communication Scheme for WiFi/ZigBee Coexisting Networks

2017

In this paper we show how inter-technology interference can be exploited to set-up a low-rate bi-directional communication channel between heterogeneous technologies, which coexist in ISM bands. In particular, we focus on WiFi and ZigBee networks, whose high density deployments make coexistence a critical issue. We monitor the transmission duration of the interference and, after recognizing ZigBee interference from WiFi off-the-shelf receivers, we precisely measure the channel busy intervals to map time duration to communication symbols. A similar approach is used on the ZigBee receivers for making the communication channel bidirectional. Extensive experimental results show the feasibility …

ZigBeeSettore ING-INF/03 - TelecomunicazioniComputerSystemsOrganization_COMPUTER-COMMUNICATIONNETWORKScoexistenceWiFi ZigBee wireless networkComputerSystemsOrganization_SPECIAL-PURPOSEANDAPPLICATION-BASEDSYSTEMSWireless LAN
researchProduct

Decentralized Synchronization for Zigbee wireless sensor networks in Multi-Hop Topology

2010

Abstract The most effective solution for energy saving in low-rate wireless sensor networks is maintaining each node in a doze state as long as possible. In order to guarantee network connectivity, the intervals at which the network sensors are turned on and off have to be coordinated. We analyze the Zigbee MAC performance in sensor networks deployed in multi-hop topologies. For this networks, critical inefficiencies can arise due to transmissions performed by hidden nodes. We evaluate the impact of different synchronization schemes on the network performance, both in terms of network capacity and in terms of energy consumption. We show how the synchronization function can be opportunistica…

Engineeringsensor networks; synchronization; zigbeeWireless networkbusiness.industrySettore ING-INF/03 - TelecomunicazioniGeneral MedicineEnergy consumptionsensor networks synchronization zigbeeNetwork topologyzigbeeKey distribution in wireless sensor networksSettore ING-INF/04 - Automaticasensor networksComputer Science::Networking and Internet ArchitectureMobile wireless sensor networkNetwork performanceSettore MAT/09 - Ricerca OperativabusinessWireless sensor networksynchronizationNeuRFonComputer network
researchProduct

An Embedded System for the integration of a Combined Photovoltaic Solar (CPS) system into a ZigBee Home Area Network

2011

In this paper is reported the design and implementation of an electronic system capable of communicating over a standard ZigBee network in order to let a residential gateway collector, named agent, gain access to the parameters of a Combined Photovoltaic and Solar thermal (CPS) plant, thus realizing a networked energy production appliance . The system is made of three parts: a PV metering device, a boiler metering device also capable of controlling a heating resistor embedded within the boiler tank, and a data collector acting as a ZigBee node. The data collector device periodically retrieves the following parameters from the metering devices: instantaneous photovoltaic power production, ac…

Settore ING-INF/03 - TelecomunicazioniBEYWATCH (Building EnergY WATCHer) CPS (Combined Photovoltaic Solar System) grid hot water electrical energy ZigBEE Wireless Sensor Networks.Settore ING-INF/01 - Elettronica
researchProduct

Error-Based Interference Detection in WiFi Networks

2017

In this paper we show that inter-technology interference can be recognized by commodity WiFi devices by monitoring the statistics of receiver errors. Indeed, while for WiFi standard frames the error probability varies during the frame reception in different frame fields (PHY, MAC headers, payloads) protected with heterogeneous coding, errors may appear randomly at any point during the time the demodulator is trying to receive an exogenous interfering signal. We thus detect and identify cross-technology interference on off-the-shelf WiFi cards by monitoring the sequence of receiver errors (bad PLCP, bad PCS, invalid headers, etc.) and develop an Artificial Neural Network (ANN) to recognize t…

Artificial Neural NetworkNeuronsMonitoringComputer scienceSettore ING-INF/03 - Telecomunicazioni05 social sciencesReal-time computingComputerSystemsOrganization_COMPUTER-COMMUNICATIONNETWORKS050801 communication & media studies020206 networking & telecommunicationsWireless LAN02 engineering and technologySpectrum managementReceiversZigBee0508 media and communicationsComputer Networks and CommunicationPHYHardware and Architecture0202 electrical engineering electronic engineering information engineeringLong Term EvolutionDemodulationWireless fidelitySafety Risk Reliability and QualityInterference
researchProduct

Cross-Technology WiFi/ZigBee Communications: Dealing With Channel Insertions and Deletions

2016

In this letter, we show how cross-technology interference can be exploited to set up a low-rate bidirectional communication channel between heterogeneous WiFi and ZigBee networks. Because of the environment noise and receivers' implementation, the cross-technology channel can be severely affected by insertions and deletions of symbols, whose effects need to be taken into account by the coding scheme and communication protocol.

Settore ING-INF/03 - TelecomunicazioniComputer sciencebusiness.industryWiFichannelinterferencewireless coexistenceComputer Science Applications1707 Computer Vision and Pattern Recognition020206 networking & telecommunications020302 automobile design & engineeringinterference; wireless coexistence; WLAN; Modeling and Simulation; Computer Science Applications1707 Computer Vision and Pattern Recognition; Electrical and Electronic Engineering02 engineering and technologyComputer Science ApplicationsWLANZigBee0203 mechanical engineeringModeling and Simulation0202 electrical engineering electronic engineering information engineeringElectrical and Electronic EngineeringbusinessCommunications protocolComputer networkCommunication channelIEEE Communications Letters
researchProduct