Search results for "amer"

showing 10 items of 2105 documents

Il valore delle differenze. Tipicità e terroir nella cultura enogastronomica

2020

storia dell'alimentazioneindicazioni geografichefood studierecipecucina italiano americanatraditional cuisinerestaurantstudi alimentariDOPSettore M-FIL/05 - Filosofia E Teoria Dei Linguaggisemiotichaute cuisinelocal cuisinecucina localepatrimonio alimentarestudi italiano americanisemioticafood historytipicalityanthropology of foodcucina tradizionaleItalian American food cultureIGPalta cucinageographical indicationcookbookfood heritagetipicitàricettariSTGantropologia dell'alimentazioneristoranti
researchProduct

The Hexameric Resorcinarene Capsule as a Brønsted Acid Catalyst for the Synthesis of Bis(heteroaryl)methanes in a Nanoconfined Space

2019

Herein, we show that the hexameric resorcinarene capsule C is able to catalyze the formation of bis(heteroaryl)methanes by reaction between pyrroles or indoles and carbonyl compounds (α-ketoesters or aldehydes) in excellent yields and selectivity. Our results suggest that the capsule can play a double catalytic role as a H-bond catalyst, for the initial activation of the carbonyl substrate, and as a Bronsted acid catalyst, for the dehydration of the intermediate alcohol.

supramolecular organocatalysisAlcohol02 engineering and technology010402 general chemistry01 natural sciencesCatalysislcsh:Chemistrychemistry.chemical_compoundPolymer chemistryBrønsted acid catalystOriginal ResearchChemistrySubstrate (chemistry)CapsuleH-bond catalystGeneral Chemistryself-assemblyResorcinareneSupramolecular organocatalysis; Resorcinarene hexameric capsule; Bis(heteroaryl)methanes; Self-assembly; H-bond catalyst; Brønsted acid catalyst021001 nanoscience & nanotechnology0104 chemical sciencesChemistrylcsh:QD1-999Self-assembly0210 nano-technologyBrønsted–Lowry acid–base theorySelectivityresorcinarene hexameric capsulebis(heteroaryl)methanesFrontiers in Chemistry
researchProduct

Physics meets Bohemia Einstein in Bohemia Michael D. Gordin Princeton University Press, 2020. 360 pp.

2020

In Einstein in Bohemia, Michael Gordin seeks to illuminate the elusive sig­nificance of Einstein9s brief tenure in Prague, both for the biography of the famous physi­cist and for the cultural history of Bohemia. An expert in the his­tory of modern physical sciences and of Russian, European, and American history, Gordin pulls together a wealth of infor­mation about the wider context of Einstein9s stay in Prague and of the cultural, scientific, and political history of Bohemia.

symbols.namesakeMultidisciplinaryCultural historyAmerican historyPolitical historysymbolsBiographyContext (language use)EinsteinClassicsScience
researchProduct

Reduced Order Models for Pricing European and American Options under Stochastic Volatility and Jump-Diffusion Models

2017

Abstract European options can be priced by solving parabolic partial(-integro) differential equations under stochastic volatility and jump-diffusion models like the Heston, Merton, and Bates models. American option prices can be obtained by solving linear complementary problems (LCPs) with the same operators. A finite difference discretization leads to a so-called full order model (FOM). Reduced order models (ROMs) are derived employing proper orthogonal decomposition (POD). The early exercise constraint of American options is enforced by a penalty on subset of grid points. The presented numerical experiments demonstrate that pricing with ROMs can be orders of magnitude faster within a give…

ta113Mathematical optimizationGeneral Computer ScienceStochastic volatilityDifferential equationEuropean optionMonte Carlo methods for option pricingJump diffusion010103 numerical & computational mathematics01 natural sciencesTheoretical Computer Science010101 applied mathematicsValuation of optionsModeling and Simulationlinear complementary problemRange (statistics)Asian optionreduced order modelFinite difference methods for option pricing0101 mathematicsAmerican optionoption pricingMathematicsJournal of Computational Science
researchProduct

Reduced Order Models for Pricing American Options under Stochastic Volatility and Jump-diffusion Models

2016

American options can be priced by solving linear complementary problems (LCPs) with parabolic partial(-integro) differential operators under stochastic volatility and jump-diffusion models like Heston, Merton, and Bates models. These operators are discretized using finite difference methods leading to a so-called full order model (FOM). Here reduced order models (ROMs) are derived employing proper orthogonal decomposition (POD) and non negative matrix factorization (NNMF) in order to make pricing much faster within a given model parameter variation range. The numerical experiments demonstrate orders of magnitude faster pricing with ROMs. peerReviewed

ta113Mathematical optimizationStochastic volatilityDiscretizationComputer scienceJump diffusionFinite difference method010103 numerical & computational mathematics01 natural sciencesNon-negative matrix factorization010101 applied mathematicsValuation of optionslinear complementary problemRange (statistics)General Earth and Planetary SciencesApplied mathematicsreduced order modelFinite difference methods for option pricing0101 mathematicsAmerican optionoption pricingGeneral Environmental ScienceProcedia Computer Science
researchProduct

Iterative Methods for Pricing American Options under the Bates Model

2013

We consider the numerical pricing of American options under the Bates model which adds log-normally distributed jumps for the asset value to the Heston stochastic volatility model. A linear complementarity problem (LCP) is formulated where partial derivatives are discretized using finite differences and the integral resulting from the jumps is evaluated using simple quadrature. A rapidly converging fixed point iteration is described for the LCP, where each iterate requires the solution of an LCP. These are easily solved using a projected algebraic multigrid (PAMG) method. The numerical experiments demonstrate the efficiency of the proposed approach. Furthermore, they show that the PAMG meth…

ta113Mathematical optimizationStochastic volatilityDiscretizationIterative methodComputer scienceFinite difference methodLinear complementarity problemIterative methodQuadrature (mathematics)Multigrid methodFixed-point iterationBates modelLinear complementarity problemGeneral Earth and Planetary SciencesPartial derivativeAmerican optionGeneral Environmental ScienceProcedia Computer Science
researchProduct

Accelerating the Americanization of Management Education

2015

The Journal of Management Inquiry astutely predicted in 2004 that the Americanization of business education would not just continue but increase. Ten years later, it is arguable that the acceleration of the Americanization of management education has exceeded all expectations. To theoretically build toward understanding how and why the American business education model has been adopted to different extents, this comparative study builds on the institutional logics perspective, arguing that different institutional logics can potentially explain the various forms and patterns of Americanization and how they are manifested in the world’s business schools.

ta511Higher educationBusiness educationbusiness.industryStrategy and ManagementAmericanizationinstitutional logicsmarketizationAmerican modelGeneral Business Management and AccountingCorporatizationhigher educationManagement of Technology and InnovationSociologySocial scienceMarketizationbusinessta512corporatizationJournal of Management Inquiry
researchProduct

Empowering Latina scientists

2019

ta520woman's statusWorld Wide Webtasa-arvoequality (values)Latin AmericaMultidisciplinaryMEDLINEscientific communitiestiedeyhteisötnaisen asemaLatinalainen AmerikkaScience
researchProduct

CCTVCV: Computer Vision model/dataset supporting CCTV forensics and privacy applications

2022

The increased, widespread, unwarranted, and unaccountable use of Closed-Circuit TeleVision (CCTV) cameras globally has raised concerns about privacy risks for the last several decades. Recent technological advances implemented in CCTV cameras, such as Artificial Intelligence (AI)-based facial recognition and Internet of Things (IoT) connectivity, fuel further concerns among privacy advocates. Machine learning and computer vision automated solutions may prove necessary and efficient to assist CCTV forensics of various types. In this paper, we introduce and release the first and only computer vision models are compatible with Microsoft common object in context (MS COCO) and capable of accurately…

tekninen rikostutkintasovellukset (soveltaminen)datasetsobject detectiontekoälyprivacykameratcomputer visiontietosuojamachine learningkoneoppiminencamerasyksityisyyskameravalvontavideo surveillancekonenäköCCTVmappingkasvontunnistus (tietotekniikka)2022 IEEE International Conference on Trust, Security and Privacy in Computing and Communications (TrustCom)
researchProduct

CCTV-FullyAware: toward end-to-end feasible privacy-enhancing and CCTV forensics applications

2022

It is estimated that over 1 billion Closed-Circuit Television (CCTV) cameras are operational worldwide. The advertised main benefits of CCTV cameras have always been the same; physical security, safety, and crime deterrence. The current scale and rate of deployment of CCTV cameras bring additional research and technical challenges for CCTV forensics as well, as for privacy enhancements. This paper presents the first end-to-end system for CCTV forensics and feasible privacy-enhancing applications such as exposure measurement, CCTV route recovery, CCTV-aware routing/navigation, and crowd-sourcing. For this, we developed and evaluated four complex and distinct modules (CCTVCV [1], OSRM-CCTV [2],…

tekninen rikostutkintatietosuojamachine learningkoneoppiminenyksityisyyskameravalvontaobject detectionvideo surveillancekonenäkönavigationsovellusohjelmatyksilönsuojaprivacy-enhancing technologies2022 IEEE International Conference on Trust, Security and Privacy in Computing and Communications (TrustCom)
researchProduct