Search results for "antico"

showing 10 items of 736 documents

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Residual vein obstruction in patients diagnosed with acute isolated distal deep vein thrombosis associated with active cancer.

2018

After acute proximal deep vein thrombosis (DVT) the thrombotic mass decreases, especially during the first months of anticoagulation. The persistence of residual vein obstruction (RVO) may predict future recurrence in patients with cancer-associated DVT. We aimed to evaluate the proportion of patients with RVO after an episode of cancer associated isolated distal DVT (IDDVT), to identify variables associated with RVO, and to provide initial evidence of its association with recurrent VTE. We performed a post-hoc analysis of a multicenter cohort study of patients with isolated cancer-associated acute IDDVT. We included patients who underwent a control ultrasonography at the end of the anticoa…

AdultMalemedicine.medical_specialtymedicine.drug_classDeep vein030204 cardiovascular system & hematologyCompression ultrasound; Distal deep vein thrombosis; Recurrence; Residual vein obstruction; Venous thromboembolism; Hematology; Cardiology and Cardiovascular Medicine03 medical and health sciences0302 clinical medicineRecurrenceRisk FactorsInternal medicineNeoplasmsmedicineHumansIn patientDistal deep vein thrombosiAgedUltrasonographyVenous ThrombosisHematologybusiness.industryRisk FactorAnticoagulantAnticoagulantCancerAnticoagulantsHematologyVenous ThromboembolismCompression ultrasoundMiddle Agedmedicine.diseaseThrombosisSurgeryDiscontinuationmedicine.anatomical_structureDistal deep vein thrombosis030220 oncology & carcinogenesisResidual vein obstructionAcute DiseaseNeoplasmFemalebusinessCardiology and Cardiovascular MedicineHumanCohort studyJournal of thrombosis and thrombolysis
researchProduct

Residual vein thrombosis to establish duration of anticoagulation after a first episode of deep vein thrombosis: the Duration of Anticoagulation base…

2008

Abstract Residual vein thrombosis (RVT) indicates a prothrombotic state and is useful for evaluating the optimal duration of oral anticoagulant treatment (OAT). Patients with a first episode of deep vein thrombosis, treated with OAT for 3 months, were managed according to RVT findings. Those with RVT were randomized to either stop or continue anticoagulants for 9 additional months, whereas in those without RVT, OAT was stopped. Outcomes were recurrent venous thromboembolism and/or major bleeding. Residual thrombosis was detected in 180 (69.8%) of 258 patients; recurrent events occurred in 27.2% of those who discontinued (25/92; 15.2% person-years) and 19.3% of those who continued OAT (17/88…

AdultMalemedicine.medical_specialtymedicine.drug_classDeep veinImmunologyHemorrhageBiochemistryDrug Administration ScheduleSettore MED/15 - Malattie Del SangueDeep vein thrombosioral anticoagulantSecondary PreventionmedicineHumansAgedUltrasonographyVenous ThrombosisFirst episoderesidual vein thrombosisVascular diseasebusiness.industryAnticoagulantHazard ratioAnticoagulantsCell BiologyHematologyMiddle Agedmedicine.diseaseSettore MED/11 - Malattie Dell'Apparato CardiovascolareThrombosisConfidence intervalSurgeryVenous thrombosisTreatment Outcomemedicine.anatomical_structureFemalebusinessBlood
researchProduct

Prevention of deep vein thrombosis in neurosurgical patients: a prospective double-blind comparison of two prophylactic regimen.

1992

In a prospective, randomized, double-blind investigation of anticoagulant agents for prevention of deep vein thrombosis in patients undergoing operations at the lumbar-vertebral disc, 179 patients were randomly allocated to two groups. 87 patients received a fixed combination of low-molecular weight heparin 1,500 U-aPTT plus dihydroergotamine 0.5 mg (LMWH/DHE) once a day and additionally one injection of placebo per day, 92 patients received a fixed combination of sodium heparin 5,000 U plus dihydroergotamine 0.5 mg (HDHE) twice a day. Treatment was initiated two hours preoperatively in both groups and continued for at least seven days. Deep vein thrombosis (DVT), detected by the 125Iodine-…

AdultMalemedicine.medical_specialtymedicine.drug_classDeep veinLow molecular weight heparinHemorrhageDihydroergotaminePostoperative ComplicationsDouble-Blind MethodRisk FactorsAntithromboticmedicineHumansProspective StudiesAgedLumbar Vertebraebusiness.industryHeparinAnticoagulantGeneral MedicineHeparinHeparin Low-Molecular-WeightMiddle AgedThrombophlebitismedicine.diseaseThrombosisSurgeryRegimenDrug Combinationsmedicine.anatomical_structureAnesthesiaSurgeryFemaleNeurology (clinical)businessDihydroergotamineIntervertebral Disc Displacementmedicine.drugNeurosurgical review
researchProduct

Laboratory control of minimal heparinization during haemodialysis in patients with a risk of haemorrhage

1994

Abstract For patients undergoing dialysis with a high risk of haemorrhage there is no standardized procedure for anticoagulation during extracorporeal circulation. Minimal heparinization with a dose equivalent to half that used for chronic haemodialysis was employed in 49 patients (125 haemodialyses) performed after operative interventions (83.3%), after haemorrhagic events (5.2%) and after invasive investigations (11.5%). Using a biocompatible membrane and a low molecular weight heparin (bolus dose 500-1300 U; continuous infusion 100-400 U) it was possible to complete haemodialysis in 74 cases (Group 0) without clots appearing in the venous bubble trap of the tubing system. In 30 cases (Gr…

AdultMalemedicine.medical_specialtymedicine.drug_classmedicine.medical_treatmentAntithrombin IIILow molecular weight heparinHemorrhageFibrin Fibrinogen Degradation ProductsClinical ProtocolsRenal DialysisRisk FactorsmedicineHumansIn patientRisk factorDialysisAgedMonitoring PhysiologicDose-Response Relationship Drugbusiness.industryAnticoagulantExtracorporeal circulationHematologyGeneral MedicineHeparinHeparin Low-Molecular-WeightMiddle AgedAntifibrinolytic AgentsSurgeryFemaleHemodialysisbusinessPeptide Hydrolasesmedicine.drugBlood Coagulation & Fibrinolysis
researchProduct

Monitoring prothrombin fragment 1+2 during initiation of oral anticoagulant therapy after intracoronary stenting

1992

Patients with intracoronary stent implantation are treated with aggressive anticoagulant and antiplatelet therapy consisting of high-dose heparin, phenprocoumon, acetylsalicylic acid, dipyridamole, and the infusion of dextran to prevent a subacute thrombotic occlusion of the stented segment. In an effort to optimize this treatment by reducing both imminent bleeding complications and subacute thrombotic occlusion, the concentrations of prothrombin fragment 1 + 2 (F 1 + 2) were determined after intracoronary Palmaz-Schatz stent implantation in 19 consecutive patients. The F 1 + 2 concentrations after stent implantation and before the initiation of oral anticoagulant therapy (OAT) were 0.35 nm…

AdultMalemedicine.medical_specialtymedicine.drug_classmedicine.medical_treatmentUrologyAdministration OralPhenprocoumonmedicineHumansAngioplasty Balloon CoronaryAgedChemotherapyHeparinbusiness.industryPROTHROMBIN FRAGMENT 1.2AnticoagulantAnticoagulantsHematologyGeneral MedicineHeparinMiddle AgedThrombophlebitismedicine.diseaseThrombosisPeptide FragmentsDipyridamoleHeart Valve ProsthesisAnesthesiaPhenprocoumonFemaleProthrombinStentsPulmonary EmbolismComplicationbusinessmedicine.drugAnnals of Hematology
researchProduct

How to Handle Arterial Conduits in Liver Transplantation? Evidence From the First Multicenter Risk Analysis

2020

OBJECTIVE: The aims of the present study were to identify independent risk factors for conduit occlusion, compare outcomes of different AC placement sites, and investigate whether postoperative platelet antiaggregation is protective. BACKGROUND: Arterial conduits (AC) in liver transplantation (LT) offer an effective rescue option when regular arterial graft revascularization is not feasible. However, the role of the conduit placement site and postoperative antiaggregation is insufficiently answered in the literature. STUDY DESIGN: This is an international, multicenter cohort study of adult deceased donor LT requiring AC. The study included 14 LT centers and covered the period from January 2…

AdultMalemedicine.medical_specialtymedicine.medical_treatmentLiver transplantationRevascularizationRisk Assessment03 medical and health sciences0302 clinical medicineRisk FactorsLTOcclusionmedicineClinical endpointHumansAorta AbdominalVascular Patencybusiness.industryAnastomosis SurgicalGraft SurvivalAnticoagulantsThrombosisPerioperativeMiddle AgedArterial occlusionSurgeryLiver TransplantationRegimenLiver030220 oncology & carcinogenesis030211 gastroenterology & hepatologySurgeryFemalebusinessVascular Surgical ProceduresCohort study
researchProduct

Phenprocoumon-induced liver disease ranges from mild acute hepatitis to (sub-) acute liver failure

2003

Abstract Background/Aims Except for bleeding complications, other serious adverse reactions of coumarin anticoagulants such as hepatotoxicity or skin necrosis are comparatively rare. Nonetheless, a small number of coumarin-induced (sub-) acute liver failures has been published. Methods A retrospective analysis was performed of patients treated for liver disease between 1992 and 2002 at our department to evaluate the incidence, clinical findings and histopathology of coumarin-induced hepatotoxicity. Results The retrospective analysis revealed eight cases of phenprocoumon-induced hepatotoxicity, including three cases of (sub-) acute liver failure which resulted in two orthotopic liver transpl…

AdultMalemedicine.medical_specialtymedicine.medical_treatmentLiver transplantationSeverity of Illness IndexGastroenterologyPhenprocoumonLiver diseaseGermanyInternal medicinemedicineHumansAdverse effectRetrospective StudiesHepatitisLiver injuryHepatologybusiness.industryLiver cellAnticoagulantsLiver Failure AcuteMiddle Agedmedicine.diseaseSurgeryAcute DiseasePhenprocoumonFemaleChemical and Drug Induced Liver InjuryComplicationbusinessmedicine.drugJournal of Hepatology
researchProduct

Predictive value of venous thromboembolism (VTE)-BLEED to predict major bleeding and other adverse events in a practice-based cohort of patients with…

2018

Summary Venous thromboembolism (VTE)‐BLEED, a decision tool for predicting major bleeding during chronic anticoagulation for VTE has not yet been validated in practice‐based conditions. We calculated the prognostic indices of VTE‐BLEED for major bleeding after day 30 and day 90, as well as for recurrent VTE and all‐cause mortality, in 4457 patients enrolled in the international, prospective XALIA study. The median at‐risk time was 190 days (interquartile range 106–360). The crude hazard ratio (HR) for major bleeding after day 30 was 2·6 [95% confidence interval (CI) 1·3–5·2] and the treatment‐adjusted HR was 2·3 (95% CI 1·1–4·5) for VTE‐BLEED high (versus low) risk patients: the correspondi…

AdultMalemedicine.medical_specialtyvenous thromboembolismHemorrhage030204 cardiovascular system & hematologyDisease-Free Survival03 medical and health sciencesYoung Adult0302 clinical medicineInterquartile rangePredictive Value of TestsInternal medicinemedicineanticoagulation therapy; bleeding; prediction; rivaroxaban; venous thromboembolism; HematologyHumans030212 general & internal medicinecardiovascular diseasesProspective StudiesAdverse effectrivaroxabanRivaroxabananticoagulation therapybusiness.industryIncidence (epidemiology)Platelets Haemostasis and ThrombosisHazard ratioHematologypredictionBleedMiddle Agedequipment and suppliesbleedingConfidence intervalddc:Survival RateCohortFemalebusinessmedicine.drugResearch Paper
researchProduct

Degree of Postictal Suppression Depends on Seizure Induction Time in Magnetic Seizure Therapy and Electroconvulsive Therapy.

2017

OBJECTIVES Anesthesia is required for both magnetic seizure therapy (MST) and electroconvulsive therapy (ECT), although it has anticonvulsant properties. In this case, bispectral index (BIS) monitoring, a specific electroencephalogram-derived monitoring, can be used to find the optimal seizure induction time during anesthesia to elicit adequate seizures. A measurement of seizure adequacy in electroencephalogram is the postictal suppression. The purpose of this study was to investigate the influence of seizure induction time on the degree of postictal suppression by comparing BIS versus no-BIS monitoring in MST and ECT. METHODS Twenty patients with treatment-resistant depression were randoml…

AdultMalemedicine.medical_treatmentNeuroscience (miscellaneous)law.invention03 medical and health sciencesDepressive Disorder Treatment-Resistant0302 clinical medicineElectroconvulsive therapyConsciousness MonitorsElectromagnetic FieldsRandomized controlled triallawPredictive Value of TestsSeizuresmedicineHumansAnesthesiaProspective StudiesElectroconvulsive TherapyAgedPsychiatric Status Rating ScalesCross-Over Studiesbusiness.industryElectroencephalographyMiddle AgedCrossover study030227 psychiatryPsychiatry and Mental healthAnticonvulsantTreatment OutcomeMagnetic seizure therapyBispectral indexAnesthesiaBrain stimulationFemaleAnalysis of variancebusinesshuman activities030217 neurology & neurosurgeryThe journal of ECT
researchProduct