Search results for "anticonvulsant"

showing 10 items of 141 documents

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Degree of Postictal Suppression Depends on Seizure Induction Time in Magnetic Seizure Therapy and Electroconvulsive Therapy.

2017

OBJECTIVES Anesthesia is required for both magnetic seizure therapy (MST) and electroconvulsive therapy (ECT), although it has anticonvulsant properties. In this case, bispectral index (BIS) monitoring, a specific electroencephalogram-derived monitoring, can be used to find the optimal seizure induction time during anesthesia to elicit adequate seizures. A measurement of seizure adequacy in electroencephalogram is the postictal suppression. The purpose of this study was to investigate the influence of seizure induction time on the degree of postictal suppression by comparing BIS versus no-BIS monitoring in MST and ECT. METHODS Twenty patients with treatment-resistant depression were randoml…

AdultMalemedicine.medical_treatmentNeuroscience (miscellaneous)law.invention03 medical and health sciencesDepressive Disorder Treatment-Resistant0302 clinical medicineElectroconvulsive therapyConsciousness MonitorsElectromagnetic FieldsRandomized controlled triallawPredictive Value of TestsSeizuresmedicineHumansAnesthesiaProspective StudiesElectroconvulsive TherapyAgedPsychiatric Status Rating ScalesCross-Over Studiesbusiness.industryElectroencephalographyMiddle AgedCrossover study030227 psychiatryPsychiatry and Mental healthAnticonvulsantTreatment OutcomeMagnetic seizure therapyBispectral indexAnesthesiaBrain stimulationFemaleAnalysis of variancebusinesshuman activities030217 neurology & neurosurgeryThe journal of ECT
researchProduct

Epilepsy in the Elderly

2009

Epilepsy is the third most common disease affecting the brain in the elderly. Current demographic trends will lead to an increased prevalence of epilepsy in the general population.A selective literature search revealed 102 relevant publications as of September 2008, 50 of which were original articles.The level of evidence was found to be very low. No guidelines, systematic reviews or meta-analyses are available, and there have been only three randomized, double-blind trials of treatment for epilepsy in the elderly. The seizures often escape clinical attention, because premonitory symptoms (aura) and secondary generalization into tonic-clonic seizures are both rarer in older patients. On the…

Aged 80 and overGeriatricsmedicine.medical_specialtyEpilepsyStatement (logic)business.industryConflict of interestDiagnostic testGeriatric assessmentReview ArticleGeneral Medicinemedicine.diseaseEpilepsymedicineHumansAnticonvulsantsPsychiatrybusinessGeriatric AssessmentAgedDeutsches Ärzteblatt international
researchProduct

Evidences of cannabinoids-induced modulation of paroxysmal events in an experimental model of partial epilepsy in the rat.

2009

The anticonvulsant effect of cannabinoids (CB) has been shown to be mediated by the activation of the CB(1) receptor. This study evaluates the anticonvulsant activity of (R)-(+)-[2,3-dihydro-5-methyl-3-(4-morpholinylmethyl) pyrrolo[1,2,3-de]-1,4-benzoxazin-6-Yl]-1-naphthalenylmethanone (WIN55,212-2, CB agonist) alone or preceded by the administration of N-(piperidin-1-yl)-5-(4-iodophenyl)-1-(2,4-dichlorophenyl)-4-methyl-1H-pyrazole-3-carboxamide (AM251, selective CB(1) antagonist) in an experimental in vivo model of complex partial seizures (maximal dentate gyrus activation - MDA) in the rat. WIN55,212-2 (21mgkg(-1)) exerted an anticonvulsant effect, significantly reduced by the pre-treatme…

AgonistAM251Malemedicine.medical_specialtyCannabinoid receptormedicine.drug_classmedicine.medical_treatmentMorpholinesNaphthalenesSettore BIO/09 - FisiologiaEpilepsyPiperidinesReceptor Cannabinoid CB1Internal medicineControlCannabinoid Receptor ModulatorsmedicineAnimalsRats WistarReceptorEpilepsyChemistryCannabinoidsGeneral NeuroscienceAntagonistBrainmedicine.diseaseCalcium Channel BlockersElectric StimulationBenzoxazinesRatsDisease Models AnimalMaximal dentate activationAnticonvulsantEndocrinologySettore BIO/14 - FarmacologiaRatPyrazolesAnticonvulsantsCannabinoidEpilepsies Partialmedicine.drugNeuroscience letters
researchProduct

Modulation of visual cortex excitability in migraine with aura: effects of valproate therapy.

2009

We explored the effects of valproate treatment on visual cortex excitability changes in migraine with aura patients. Abnormal cortical excitability has been suggested to play an important role in the etiopathogenesis of migraine; in particular, it has been suggested a failure of inhibitory circuits in migraine with aura. Valproate acts as a central GABA agonist and it is reasonable suppose that VPA could modify cortical excitability state. Phosphene threshold (PT) was assessed at baseline and after 1 Hz rTMS before and after one month therapy. We found that low-frequency rTMS in drug-free migraineurs decreased PT, while the treatment with the GABA agonist valproate is able to revert the eff…

AgonistAdultMaleTime Factorsmedicine.drug_classGABA Agentsmedicine.medical_treatmentMigraine with AuraPhosphenesSettore BIO/09 - FisiologiaYoung AdultCortex (anatomy)medicineHumansvisual cortex excitability migraine with auraVisual CortexValproic AcidAnalysis of VarianceGeneral NeuroscienceValproic AcidMiddle Agedmedicine.diseaseTranscranial Magnetic StimulationMigraine with auraAnticonvulsantVisual cortexmedicine.anatomical_structurePhosphenenervous systemMigraineSettore MED/26 - NeurologiaFemalemedicine.symptomPsychologyNeurosciencemedicine.drugNeuroscience letters
researchProduct

Role of CB2 receptors and cGMP pathway on the cannabinoid-dependent antiepileptic effects in an in vivo model of partial epilepsy.

2014

This study aimed at providing an insight on the possible role of cannabi-noid (CB) type 2 receptors (CB2R) and cGMP pathway in the antiepileptic activity ofWIN 55,212-2, (R)-(+)-[2,3-dihydro-5-methyl-3-(4-morpholinylmethyl) pyrrolo[1,2,3-de]-1,4-benzoxazin-6-Yl]-1-naphthalenylmethanone, a non-selective CB agonist, in the maximal dentate activation (MDA) model of partial epilepsy in adult male rats. We evaluated the activity of a CB2 antagonist/inverse agonist AM630, [6-iodo-2-methyl-1-[2-(4-morpholinyl)ethyl]-1H-indol-3-yl](4-methoxyphenyl)methanone or 6-iodopravadoline, alone or in co-administration with WIN 55,212-2. Also, in the MDA model it was investigated the co-treatment of WIN55,212…

AgonistMaleIndolessGCmedicine.drug_classmedicine.medical_treatmentMorpholinesPharmacologyNaphthalenesSettore BIO/09 - FisiologiaHippocampusNitric oxideReceptor Cannabinoid CB2chemistry.chemical_compoundHippocampumedicineCannabinoid receptor type 2Inverse agonistAnimalsRats WistarReceptorCannabinoidCannabinoid Receptor AntagonistsCyclic GMPCannabinoid Receptor AgonistsElectrophysiology.ChemistryAntagonistElectric StimulationBenzoxazinesDisease Models AnimalNeurologyGuanylate CyclaseAnticonvulsantsNeurology (clinical)CannabinoidEpilepsies PartialSoluble guanylyl cyclaseTemporal Lobe Epilepsy AM630Epilepsy research
researchProduct

Adjunctive Brivaracetam in Older Patients with Focal Seizures: Evidence from the BRIVAracetam add‑on First Italian netwoRk Study (BRIVAFIRST).

2022

BACKGROUND: The management of epilepsy in older adults has become part of daily practice because of an aging population. Older patients with epilepsy represent a distinct and more vulnerable clinical group as compared with younger patients, and they are generally under-represented in randomized placebo-controlled trials. Real-world studies can therefore be a useful complement to characterize the drug's profile. Brivaracetam is a rationally developed compound characterized by high-affinity binding to synaptic vesicle protein 2A and approved as adjunctive therapy for focal seizures in adults with epilepsy. OBJECTIVE: The aim of this study was to assess the 12-month effectiveness and tolerabil…

Antiseizure medicationEpilepsySettore MED/26PyrrolidinonesFocal seizuresTreatment OutcomeDrug TherapyDouble-Blind MethodItalySeizuresBrivaracetamCombinationAntiseizure medication; Brivaracetam; Focal seizuresAged; Double-Blind Method; Drug Therapy Combination; Humans; Italy; Pyrrolidinones; Retrospective Studies; Seizures; Treatment Outcome; Anticonvulsants; EpilepsyHumansPharmacology (medical)Settore MED/26 - NeurologiaAnticonvulsantsDrug Therapy CombinationGeriatrics and GerontologyAgedRetrospective StudiesDrugsaging
researchProduct

Determination of phenytoin in plasma by molecularly imprinted solid-phase extraction.

2001

Abstract A molecularly imprinted polymer (MIP) using phenytoin as template and methacrylamide as the functional monomer was prepared. The selectivity was measured by comparing capacity factors of phenytoin and other structurally related compounds. The polymer was evaluated as a selective sorbent in molecularly imprinted solid-phase extraction (MISPE). Several washing solvents were tested to study their ability to disrupt the non-specific interactions occurring between the sample and the polymer matrix and the role of water in the recognition process was also investigated. It was shown that the key step of successful sample extraction is the right choice of the washing solvent. Plasma sample…

BioanalysisChromatographyChemistryPolymersOrganic ChemistryExtraction (chemistry)Molecularly imprinted polymerReproducibility of ResultsGeneral MedicineReference StandardsBiochemistryHigh-performance liquid chromatographyAnalytical ChemistryMatrix (chemical analysis)PhenytoinCalibrationHumansSample preparationAnticonvulsantsSolid phase extractionMolecular imprintingJournal of chromatography. A
researchProduct

Sexual Dysfunction and Mood Stabilizers in Long-Term Stable Patients With Bipolar Disorder.

2020

Abstract Background In addition to factors intrinsic to bipolar disorder (BD), sexual functioning (SF) can be affected by extrinsic causes, such as psychotropic drugs. However, the effect of mood stabilizers on SF and quality of life (QoL) is an underexplored research area. Aim To analyze SF in BD outpatients in euthymia for at least 6 months treated only with mood stabilizers and the association between SF and QoL. Methods A multicenter cross-sectional study was conducted in 114 BD outpatients treated with (i) lithium alone (L group); (ii) anticonvulsants alone (valproate or lamotrigine; A group); (iii) lithium plus anticonvulsants (L+A group); or (iv) lithium plus benzodiazepines (L+B gro…

Bipolar DisorderUrologyEndocrinology Diabetes and MetabolismSexual arousalmedia_common.quotation_subject030232 urology & nephrologyOrgasmLamotrigine03 medical and health sciences0302 clinical medicineEndocrinologyQuality of lifeAntimanic AgentsMedicineHumansBipolar disordermedia_commonAged030219 obstetrics & reproductive medicinebusiness.industrymedicine.diseasePsychiatry and Mental healthSexual desireSexual dysfunctionMoodCross-Sectional StudiesReproductive MedicineQuality of LifeAnticonvulsantsFemalemedicine.symptombusinessClinical psychologymedicine.drugAntipsychotic AgentsThe journal of sexual medicine
researchProduct

Panniculitis due to potassium bromide.

1998

Potassium bromide again is well known to be surprisingly effective in patients with severe myoclonic epilepsy in infants (SME). Rare side effects on the skin reappeared, such as the febrile nodular panniculitis (Weber-Christian syndrome). In 1993 we described the first three cases of necrotizing panniculitis and introduced the term 'halogen panniculitis'. It is a systemic disease with crops of subcutaneous nodules, fever, elevated sedimentation rate, hepatosplenomegalia, and abdominal pain. Later severe necrosis of the skin and adipose tissue may happen with deep ulcerations. History and course of five cases, described in this paper, suggest either an allergy or toxic reason. Histologic pic…

BromidesMaleSystemic diseaseAbdominal painPathologymedicine.medical_specialtyAllergyNecrosisPanniculitisAdolescentPotassium CompoundsAdipose tissueInflammationSkin DiseasesDevelopmental NeuroscienceRecurrenceSkin UlcermedicineHumansChildRetrospective StudiesEpilepsybusiness.industryGeneral Medicinemedicine.diseaseChild PreschoolPediatrics Perinatology and Child HealthMyoclonic epilepsyAnticonvulsantsFemaleNeurology (clinical)medicine.symptomPanniculitisbusinessBraindevelopment
researchProduct