Search results for "asma"

showing 10 items of 4204 documents

Prospettive interdisciplinari per una rifunzionalizzazione della fantasmagoria

2020

A partire dagli studi sulla riconfigurazione della fantasmagoria maturati all’interno del progetto "Ricezione, rifunzionalizzazione, multimodalità del Centro di Ricerca Interuniversitario di Argomentazione, Pragmatica e la Stilistica (Argo)" con questo volume si intendono percorrere diacronicamente le molteplici declinazioni della fantasmagoria e rintracciare le modalità attraverso le quali essa si trasforma in categoria retorica. Partendo dagli studi sulla letteratura del XIX secolo che vedono la fantasmagoria connessa al fantastico qui ci si propone di interrogare in un’ottica interdisciplinare le forme di manipolazione, alterazione e sospensione della realtà che ne esemplificano il proce…

fantasmagoria rifunzionalizzazione poesia romanzoSettore L-LIN/03 - Letteratura Francese
researchProduct

Influence of flavonoids on the transmembrane electron transport:study ex-vivo

2015

The oxidative stress results from a change in the physiological balancebetween oxidant and antioxidant species. This condition induces an chemical change in the redox state of cells.. The function of t-PMET is to cooperate with intracellular redox pairs, like piruvate and lactate, to maintain thecytoplasmatic NAD+/NADH balance. The t-PMET is correlated with the modulation of internal pH and redox homeostasis, as it is able to activate proton release. Thus, t-PMET causes external and internal pH modification, as well as development of an inside negative membrane potential. The aim of this work was evaluate the erythrocytes redox status in a group of health volunteers and then to study whethe…

flavonoids trans- Plasma Membrane Electron Transport
researchProduct

Two-step cross correlation-based algorithm for motion estimation applied to fertilizer granules' motion during centrifugal spreading

2011

Imaging systems are progressing in both accuracy and ro- bustness, and their use in precision agriculture is increasing accordingly. One application of imaging systems is to understand and control the cen- trifugal fertilizing spreading process. Predicting the spreading pattern on the ground relies on an estimation of the trajectories and velocities of ejected granules. The algorithms proposed to date have shown low ac- curacy, with an error rate of a few pixels. But a more accurate estimation of the motion of the granules can be achieved. Our new two-step cross- correlation-based algorithm is based on the technique used in particle image velocimetry (PIV), which has yielded highly accurate…

fluid mechanicsImage processing01 natural sciences010305 fluids & plasmas010309 opticsmotion estimationMotion estimationcameras0103 physical sciencesComputer visionImage sensorMathematicsCross-correlationPixelbusiness.industrycentrifugesGeneral EngineeringfertilisersFluid mechanicsSubpixel renderingAtomic and Molecular Physics and Opticsimage processingParticle image velocimetryvelocimetersArtificial intelligencebusinessAlgorithm
researchProduct

Adulteration detection of argan oil by inductively coupled plasma optical emission spectrometry

2010

Abstract The singularity of the trace element profile of argan oil has been demonstrated by means of inductively coupled plasma optical emission measurement in combination with different chemometric approaches. The ability of multivariate analysis methods; such as hierarchical cluster analysis (HCA), principal component analysis (PCA), classification trees using Chi -squared Automatic Interaction Detector (CHAID) and discriminant analysis (DA) to achieve edible oils classification based on its type or variety from their elemental content have been investigated. The calculations were performed using 16 variables (contents of Na, Mg, Al, K, Ca, Ti, Fe, Co, Ni, Cu, Zn, Cd, Pr, Sm, Er and Bi at…

food.ingredientChromatographyChemistrySunflower oilAnalytical chemistryTrace elementArgan oilGeneral MedicineSunflowerAnalytical ChemistryChemometricsfoodVegetable oilPrincipal component analysisInductively coupled plasmaFood ScienceFood Chemistry
researchProduct

Inductively coupled plasma optical emission spectroscopy determination of trace element composition of argan oil.

2011

A methodology based on inductively coupled plasma optical emission spectroscopy (ICP-OES) after microwave assisted acid digestion has been developed to determine the trace element content of Moroccan argan oil. Limit of detection values equal or lower than few mg/kg were obtained for all elements under study. To assure the accuracy of the whole procedure, recovery studies were carried out on argan oil samples spiked at different concentration levels from 10 to 200 µg/L. Quantitative average recovery values were obtained for all elements evaluated, demonstrating the suitability of this methodology for the determination of trace elements in argan oil samples. Aluminum, calcium, chromium, iro…

food.ingredientGeneral Chemical EngineeringAnalytical chemistrychemistry.chemical_elementVanadiumArgan oilZincIndustrial and Manufacturing EngineeringChromiumfoodLimit of DetectionPlant OilsDetection limitMagnesiumSpectrophotometry AtomicSodiumTrace elementReproducibility of ResultsTrace ElementsMoroccochemistryPotassiumCalciumInductively coupled plasmaFood AnalysisFood ScienceFood science and technology international = Ciencia y tecnologia de los alimentos internacional
researchProduct

On the discreet spectrum of fractional quantum hydrogen atom in two dimensions

2019

We consider a fractional generalization of two-dimensional (2D) quantum-mechanical Kepler problem corresponding to 2D hydrogen atom. Our main finding is that the solution for discreet spectrum exists only for $\mu>1$ (more specifically $1 < \mu \leq 2$, where $\mu=2$ corresponds to "ordinary" 2D hydrogenic problem), where $\mu$ is the L\'evy index. We show also that in fractional 2D hydrogen atom, the orbital momentum degeneracy is lifted so that its energy starts to depend not only on principal quantum number $n$ but also on orbital $m$. To solve the spectral problem, we pass to the momentum representation, where we apply the variational method. This permits to obtain approximate analytica…

fractional Schrödinger equationFOS: Physical sciencesPosition and momentum space01 natural sciences010305 fluids & plasmasSchrödinger equationMomentumsymbols.namesakeKepler problem0103 physical sciencesPrincipal quantum number010306 general physicsCondensed Matter - Statistical MechanicsMathematical PhysicsMathematical physicsPhysicsQuantum PhysicsStatistical Mechanics (cond-mat.stat-mech)fractional statisticsSpectrum (functional analysis)Mathematical Physics (math-ph)Hydrogen atomCondensed Matter PhysicsAtomic and Molecular Physics and OpticsVariational methodsymbolsQuantum Physics (quant-ph)hydrogenic problemsPhysica Scripta
researchProduct

Characterizing and Quantifying Frustration in Quantum Many-Body Systems

2011

We present a general scheme for the study of frustration in quantum systems. We introduce a universal measure of frustration for arbitrary quantum systems and we relate it to a class of entanglement monotones via an exact inequality. If all the (pure) ground states of a given Hamiltonian saturate the inequality, then the system is said to be inequality saturating. We introduce sufficient conditions for a quantum spin system to be inequality saturating and confirm them with extensive numerical tests. These conditions provide a generalization to the quantum domain of the Toulouse criteria for classical frustration-free systems. The models satisfying these conditions can be reasonably identifi…

frustrationmedia_common.quotation_subjectFOS: Physical sciencesGeneral Physics and AstronomyFrustrationQuantum capacityQuantum entanglement01 natural sciences010305 fluids & plasmasOpen quantum systemQuantum mechanics0103 physical sciencesQuantum operationStatistical physics010306 general physicsMathematical Physicsmedia_commonMathematicsQuantum PhysicsQuantum discordMathematical Physics (math-ph)Condensed Matter - Other Condensed MatterQuantum processQuantum algorithmCondensed Matter::Strongly Correlated ElectronsQuantum Physics (quant-ph)Other Condensed Matter (cond-mat.other)
researchProduct

Normal weight obesity and physical fitness in Chinese university students: an overlooked association

2018

Background: The primary aim of this study was to examine the associations of normal weight obesity (NWO) with physical fitness in Chinese university students. As a secondary aim, we assessed whether possible differences in physical fitness between students classified as NWO and normal weight non-obese (NWNO) were mediated by skeletal muscles mass. Methods: A total of 383 students (205 males and 178 females, aged 18–24 years) from two universities volunteered to participate in this study. Body height and weight were measured by standard procedures and body composition was assessed by bio-impedance analysis (InBody 720). NWO was defined by a BMI of 18.5–23.9 kg/m2 and a body fat percentage of…

fyysinen kuntolihasmassakansanterveysrasvaprosenttibody-mass indexphysical activityskeletal muscle masspainoindeksifyysinen aktiivisuuskehonkoostumus
researchProduct

Gap junction intercellular communication (GJIC) is regulated by plasmalogens in retinal macroglial cells

2019

International audience

gap junction[SDV.AEN] Life Sciences [q-bio]/Food and Nutritionretinacalcium[SDV.MHEP.OS] Life Sciences [q-bio]/Human health and pathology/Sensory Organsglia[SDV.MHEP.OS]Life Sciences [q-bio]/Human health and pathology/Sensory Organsplasmalogens[SDV.AEN]Life Sciences [q-bio]/Food and NutritionComputingMilieux_MISCELLANEOUS
researchProduct

Charge fluctuations and electric mass in a hot meson gas

2006

Net-Charge fluctuations in a hadron gas are studied using an effective hadronic interaction. The emphasis of this work is to investigate the corrections of hadronic interactions to the charge fluctuations of a non-interacting resonance gas. Several methods, such as loop, density and virial expansions are employed. The calculations are also extended to SU(3) and some resummation schemes are considered. Although the various corrections are sizable individually, they cancel to a large extent. As a consequence we find that charge fluctuations are rather well described by the free resonance gas.

gas [meson]Nuclear and High Energy PhysicsNuclear TheoryMesonresonance [gas]HadronFOS: Physical sciencesElectric chargeResonance (particle physics)fluctuation [charge]susceptibilityVirial theoremNuclear Theory (nucl-th)Nuclear physicsmass [rho(770)]electric [mass]unitarityddc:530Resummationnumerical calculationsinteraction [pi pi]Physicshigher-order [correction]effective Lagrangianvirial [expansion]High Energy Physics::PhenomenologySU(3) [symmetry]Charge (physics)relativistic [expansion]quantum [statistics]Quantum electrodynamicsQuark–gluon plasmaPhysical Review C
researchProduct