Search results for "brivaracetam"

showing 7 items of 7 documents

Brivaracetam as add-on treatment in patients with post-stroke epilepsy: real-world data from the BRIVAracetam add-on First Italian netwoRk Study (BRI…

2022

Objective: Post-stroke epilepsy (PSE) is one of the most common causes of acquired epilepsy and accounts for about 10-15% of all newly diagnosed epilepsy cases. However, evidence about the clinical profile of antiseizure medications in the PSE setting is currently limited. Brivaracetam (BRV) is a rationally developed compound characterized by high-affinity binding to synaptic vesicle protein 2A. The aim of this study was to assess the 12-month effectiveness and tolerability of adjunctive BRV in patients with PSE treated in a real-world setting. Methods: This was a subgroup analysis of patients with PSE included in the BRIVAracetam add-on First Italian netwoRk Study (BRIVAFIRST). The BRIVAFI…

AdultAntiseizure medication; Brivaracetam; Cerebrovascular diseases; Focal seizures; StrokeCerebrovascular diseasesSettore MED/26Antiseizure medication Brivaracetam Focal seizures Stroke Cerebrovascular diseasesFocal seizuresDouble-Blind MethodDrug TherapySeizuresHumansAgedRetrospective StudiesAntiseizure medicationEpilepsyGeneral MedicineMiddle AgedPyrrolidinonesStrokeTreatment OutcomeNeurologyItalyCombinationBrivaracetamAntiseizure medication; Brivaracetam; Cerebrovascular diseases; Focal seizures; Stroke; Adult; Aged; Anticonvulsants; Double-Blind Method; Drug Therapy Combination; Humans; Italy; Middle Aged; Pyrrolidinones; Retrospective Studies; Seizures; Treatment Outcome; Epilepsy; StrokeDrug Therapy CombinationAnticonvulsantsNeurology (clinical)
researchProduct

Sustained seizure freedom with adjunctive brivaracetam in patients with focal onset seizures

2022

The maintenance of seizure control over time is a clinical priority in patients with epilepsy. The aim of this study was to assess the sustained seizure frequency reduction with adjunctive brivaracetam (BRV) in real-world practice. Patients with focal epilepsy prescribed add-on BRV were identified. Study outcomes included sustained seizure freedom and sustained seizure response, defined as a 100% and a ≥50% reduction in baseline seizure frequency that continued without interruption and without BRV withdrawal through the 12-month follow-up. Nine hundred ninety-four patients with a median age of 45 (interquartile range = 32-56) years were included. During the 1-year study period, sustained se…

AdultFreedomfocal seizuresEpilepsiesSettore MED/26Double-Blind MethodDrug Therapyantiseizure medication; brivaracetam; focal seizures; seizure freedom; sodium channel blockers; Adult; Double-Blind Method; Drug Therapy Combination; Freedom; Humans; Middle Aged; Pyrrolidinones; Seizures; Treatment Outcome; Anticonvulsants; Epilepsies PartialSeizuresseizure freedomHumansanti-seizure medication; focal seizures; epilepsyantiseizure medicationbrivaracetamanti-seizure medicationMiddle AgedPyrrolidinonesTreatment OutcomeNeurologysodium channel blockersCombinationepilepsyDrug Therapy CombinationAnticonvulsantsNeurology (clinical)Epilepsies PartialPartial
researchProduct

Effects of antiepileptic drugs on cortical excitability in humans: A TMS-EMG and TMS-EEG study.

2018

Brain responses to transcranial magnetic stimulation (TMS) recorded by electroencephalography (EEG) are emergent noninvasive markers of neuronal excitability and effective connectivity in humans. However, the underlying physiology of these TMS-evoked EEG potentials (TEPs) is still heavily underexplored, impeding a broad application of TEPs to study pathology in neuropsychiatric disorders. Here we tested the effects of a single oral dose of three antiepileptic drugs with specific modes of action (carbamazepine, a voltage-gated sodium channel (VGSC) blocker; brivaracetam, a ligand to the presynaptic vesicle protein VSA2; tiagabine, a gamma-aminobutyric acid (GABA) reuptake inhibitor) on TEP a…

AdultMaleTiagabinemedicine.medical_treatmentElectroencephalographyBrivaracetam050105 experimental psychology03 medical and health scienceschemistry.chemical_compoundYoung Adult0302 clinical medicineDouble-Blind MethodMedicineHumans0501 psychology and cognitive sciencesRadiology Nuclear Medicine and imagingNeurotransmitterTiagabineEvoked PotentialsResearch ArticlesCerebral CortexN100Cross-Over StudiesRadiological and Ultrasound Technologymedicine.diagnostic_testbusiness.industryElectromyography05 social sciencesElectroencephalographyCarbamazepineTranscranial Magnetic StimulationHealthy VolunteersPyrrolidinonesTranscranial magnetic stimulationCarbamazepineNeurologychemistryAnticonvulsantsNeurology (clinical)AnatomybusinessReuptake inhibitorNeuroscience030217 neurology & neurosurgerymedicine.drugHuman brain mapping
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Adjunctive Brivaracetam in Older Patients with Focal Seizures: Evidence from the BRIVAracetam add‑on First Italian netwoRk Study (BRIVAFIRST).

2022

BACKGROUND: The management of epilepsy in older adults has become part of daily practice because of an aging population. Older patients with epilepsy represent a distinct and more vulnerable clinical group as compared with younger patients, and they are generally under-represented in randomized placebo-controlled trials. Real-world studies can therefore be a useful complement to characterize the drug's profile. Brivaracetam is a rationally developed compound characterized by high-affinity binding to synaptic vesicle protein 2A and approved as adjunctive therapy for focal seizures in adults with epilepsy. OBJECTIVE: The aim of this study was to assess the 12-month effectiveness and tolerabil…

Antiseizure medicationEpilepsySettore MED/26PyrrolidinonesFocal seizuresTreatment OutcomeDrug TherapyDouble-Blind MethodItalySeizuresBrivaracetamCombinationAntiseizure medication; Brivaracetam; Focal seizuresAged; Double-Blind Method; Drug Therapy Combination; Humans; Italy; Pyrrolidinones; Retrospective Studies; Seizures; Treatment Outcome; Anticonvulsants; EpilepsyHumansPharmacology (medical)Settore MED/26 - NeurologiaAnticonvulsantsDrug Therapy CombinationGeriatrics and GerontologyAgedRetrospective StudiesDrugsaging
researchProduct

Brivaracetam as Early Add-On Treatment in Patients with Focal Seizures: A Retrospective, Multicenter, RealWorld Study

2022

Introduction: In randomized controlled trials, add-on brivaracetam (BRV) reduced seizure frequency in patients with drug-resistant focal epilepsy. Most real-world research on BRV has focused on refractory epilepsy. The aim of this analysis was to assess the 12-month effectiveness and tolerability of adjunctive BRV when used as early or late adjunctive treatment in patients included in the BRIVAracetam add-on First Italian netwoRk Study (BRIVAFIRST). Methods: BRIVAFIRST was a 12-month retrospective, multicenter study including adult patients prescribed adjunctive BRV. Effectiveness outcomes included the rates of sustained seizure response, sustained seizure freedom, and treatment discontinua…

Antiseizure medicationFocal seizuresAntiseizure medication; Brivaracetam; Epilepsy; Focal seizures.Antiseizure medication; Brivaracetam; Epilepsy; Focal seizures;EpilepsyNeurologyBrivaracetamSettore MED/26 - NeurologiaNeurology (clinical)Antiseizure medication; Brivaracetam; Epilepsy; Focal seizuresSettore MED/26Settore MED/39 - Neuropsichiatria Infantile
researchProduct

Adjunctive Brivaracetam in Focal Epilepsy: Real-World Evidence from the BRIVAracetam add-on First Italian netwoRk STudy (BRIVAFIRST)

2021

Background: In randomized controlled trials, add-on brivaracetam (BRV) reduced seizure frequency in patients with drug-resistant focal epilepsy. Studies performed in a naturalistic setting are a useful complement to characterize the drug profile. Objective: This multicentre study assessed the effectiveness and tolerability of adjunctive BRV in a large population of patients with focal epilepsy in the context of real-world clinical practice. Methods: The BRIVAFIRST (BRIVAracetam add-on First Italian netwoRk STudy) was a retrospective, multicentre study including adult patients prescribed adjunctive BRV. Patients with focal epilepsy and 12-month follow-up were considered. Main outcomes includ…

medicine.medical_specialtybusiness.industryContext (language use)Brivaracetammedicine.diseaseDiscontinuationlaw.inventionPsychiatry and Mental healthEpilepsyRandomized controlled trialTolerabilityfocal epilepsy add-on therapy seizurelawConcomitantInternal medicineMedicinePharmacology (medical)Neurology (clinical)LevetiracetamOriginal Research Articlebusinessmedicine.drug
researchProduct