Search results for "confinement"

showing 10 items of 213 documents

Printing Life-Inspired Subcellular Scale Compartments with Autonomous Molecularly Crowded Confinement.

2019

A simple, rapid, and highly controlled platform to prepare life-inspired subcellular scale compartments by inkjet printing has been developed. These compartments consist of fL-scale aqueous droplets (few µm in diameter) incorporating biologically relevant molecular entities with programmed composition and concentration. These droplets are ink-jetted in nL mineral oil drop arrays allowing for lab-on-chip studies by fluorescence microscopy and fluorescence life time imaging. Once formed, fL-droplets are stable for several hours, thus giving the possibility of readily analyze molecular reactions and their kinetics and to verify molecular behavior and intermolecular interactions. Here, this pla…

Surface PropertiesDNA hairpinBiomedical EngineeringGeneral Biochemistry Genetics and Molecular BiologyFluorescenceBiomaterialsSettore CHIM/01molecular crowdingbiomolecular confinementlife-like compartmentFluorescence microscopeInkjet printinginkjet printingBiochemistry Genetics and Molecular Biology (all)ChemistryDrop (liquid)Intermolecular forceLife timeDNABiomaterialFluorescencebiomolecular confinement; DNA hairpins; inkjet printing; life-like compartments; molecular crowdingDNA hairpinslife-like compartmentsPrinting Three-DimensionalBiophysicsMolecular probeAdvanced biosystems
researchProduct

Overview of first Wendelstein 7-X high-performance operation

2019

Abstract The optimized superconducting stellarator device Wendelstein 7-X (with major radius , minor radius , and plasma volume) restarted operation after the assembly of a graphite heat shield and 10 inertially cooled island divertor modules. This paper reports on the results from the first high-performance plasma operation. Glow discharge conditioning and ECRH conditioning discharges in helium turned out to be important for density and edge radiation control. Plasma densities of with central electron temperatures were routinely achieved with hydrogen gas fueling, frequently terminated by a radiative collapse. In a first stage, plasma densities up to were reached with hydrogen pellet injec…

TechnologyCONFINEMENT01 natural sciencesimpurities010305 fluids & plasmaslaw.inventionECR heatingDivertorDENSITY LIMITlawData_FILESGeneralLiterature_REFERENCE(e.g.dictionariesencyclopediasglossaries)004 Datenverarbeitung; InformatikPhysicsGlow dischargeDivertorCondensed Matter PhysicsContent (measure theory)ComputingMethodologies_DOCUMENTANDTEXTPROCESSINGElectron temperatureAtomic physicsddc:620StellaratorImpuritiesNuclear and High Energy PhysicsTechnology and Engineeringplasma performancechemistry.chemical_elementAtmospheric-pressure plasmaPHYSICSstellaratorPhysics::Plasma PhysicsNBI heating0103 physical sciencesdivertor010306 general physicsHeliumStellaratorPlasma performanceturbulenceFísicaW7-XTurbulenceTheoryofComputation_MATHEMATICALLOGICANDFORMALLANGUAGESchemistryddc:004ddc:600Energy (signal processing)SYSTEMNuclear Fusion
researchProduct

Confinement à l’université et pratiques d’enseignement en France : une analyse du vécu des enseignants

2022

En France, la crise sanitaire liée à la pandémie de Covid-19 a conduit le pays à un confinement strict de sa population entre mars et mai 2020 et à la fermeture des universités. Face à une telle situation, les enseignants universitaires ont eu à s’adapter sans délai à un contexte d’enseignement à distance auquel ils étaient peu préparés (Messaoui et al., 2021). Contraints d’assurer la continuité pédagogique de leurs cours magistraux dans des circonstances jusqu’alors inédites, nombre d’entre eux ont dû en réalité affronter une situation de « rupture » (Jarraud, 2020). Mais il apparaît également que cette expérience a pu modifier leurs pratiques et les amener à reconsidérer le rôle que peuve…

UniversitéPratique enseignante[SHS.EDU] Humanities and Social Sciences/EducationFranceEnseignantPratique de l'enseignementEnseignement supérieurConfinement
researchProduct

Sea bass Dicentrarchus labrax (L.) bacterial infection and confinement stress acts on F-type lectin (DlFBL) serum modulation

2014

The F-lectin, a fucose-binding protein found from invertebrates to ectothermic vertebrates, is the last lectin family to be discovered. Here, we describe effects of two different types of stressors, bacterial infection and confinement stress, on the modulation of European sea bass Dicentrarchus labrax (L.) F-lectin (DlFBL), a well-characterized serum opsonin, using a specific antibody. The infection of the Vibrio alginolyticus bacterial strain increased the total haemagglutinating activity during the 16-day testing period. The DlFBL value showed an upward regulation on the first, second and last days and underwent a slight downward regulation 4 days post-challenge. In contrast, the effect o…

Vibrio alginolyticusbiologyVeterinary (miscellaneous)Period (gene)LectinInflammationAquatic Sciencebiology.organism_classificationMicrobiologyAgglutination (biology)Fish DiseasesStress PhysiologicalLectinsImmunologymedicinebiology.proteinAnimalsDicentrarchusBassSea bassmedicine.symptomOpsoninconfinement stress Dicentrarchus labrax F-type lectin infection modulation teleost.
researchProduct

Physicochemical Investigation of the Solubilization of Ytterbium Nitrate in AOT Reverse Micelles and Liquid Crystals

2006

A wide investigation of the solubilization of the water-soluble salt Yb(NO3)(3) in sodium bis(2-ethylhexyl)sulfosuccinate (AOT) reverse micelles and AOT liquid crystals has been carried out. After saturation of water/AOT/organic solvent w/o microemulsions with pure Yb(NO3)(3), the Yb(NO3)(3)/AOT composites were prepared by complete evaporation under vacuum of the volatile components (water and organic solvent) of the salt-containing microemulsions. It was observed that these composites can be totally dissolved in pure n-heptane or CCl4, allowing the solubilization of a noticeable amount of Yb(NO3)(3) in quite dry apolar media. By UV-vis-NIR, FT-IR, and H-1 NMR spectroscopies, some informati…

YtterbiumPolymers and PlasticsSmall-angle X-ray scatteringytterbium nitrateAOT reverse micelleInorganic chemistryAnalytical chemistrychemistry.chemical_elementMicelleColloid and Surface ChemistrychemistryPulmonary surfactantLiquid crystalMaterials ChemistryProton NMRionic clustersconfinement effectMicroemulsionPhysical and Theoretical ChemistrySaturation (chemistry)solubilization
researchProduct

Plasma diagnostic tools for ECR ion sources : What can we learn from these experiments for the next generation sources

2019

International audience; The order-of-magnitude performance leaps of ECR ion sources over the past decades result from improvements to the magnetic plasma confinement, increases in the microwave heating frequency, and techniques to stabilize the plasma at high densities. Parallel to the technical development of the ion sources themselves, significant effort has been directed into the development of their plasma diagnostic tools. We review the recent results of Electron Cyclotron Resonance Ion Source (ECRIS) plasma diagnostics highlighting a number of selected examples of plasma density, electron energy distribution, and ion confinement time measurements, obtained mostly with the second-gener…

[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Solenoidmagnetic fieldshiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesbremsstrahlungElectron cyclotron resonance010305 fluids & plasmasIonoptical emission spectroscopySuperposition principleion sourcesPhysics::Plasma Physics0103 physical sciencesInstrumentation010302 applied physicsPhysics[PHYS]Physics [physics]plasma confinementplasma properties and parametersplasma diagnosticssyklotronitplasma heatingPlasmaIon sourceComputational physicsMagnetic fieldPlasma diagnostics
researchProduct

Theoretical principles of near-field optical microscopies and spectroscopies

2000

International audience; This paper deals with the principles of detection of optical signals near a surface in a manner permitting the mapping of the distribution of the fields close to various kinds of illuminated samples. We begin with a discussion of the main physical properties of the optical fields near a surface in the absence of any probe tip. This mainly concerns phenomena involving evanescent waves for which the local decay lengths are governed not only by the sizes but also by the intrinsic properties of the surface structures. The interpretation of the detection process is reviewed on the basis of a discussion about the possibility of establishing direct comparisons between exper…

[PHYS.PHYS.PHYS-OPTICS] Physics [physics]/Physics [physics]/Optics [physics.optics]ELECTRODYNAMICSEvanescent wavePOLARIZATIONGeneral Physics and AstronomyNear and far field02 engineering and technology01 natural scienceslaw.inventionSCANNING TUNNELING MICROSCOPESINGLE MOLECULESsymbols.namesakeOpticslaw0103 physical sciencesSCATTERINGPhysical and Theoretical ChemistryFLUORESCENCE010306 general physicsPhysics[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics]SURFACE-STRUCTURESLocal density of statesLIGHT CONFINEMENT[ PHYS.PHYS.PHYS-OPTICS ] Physics [physics]/Physics [physics]/Optics [physics.optics]SELF-CONSISTENTbusiness.industryScattering021001 nanoscience & nanotechnologyPolarization (waves)Maxwell's equationsRESOLUTIONsymbolsNear-field scanning optical microscopeScanning tunneling microscope0210 nano-technologybusiness
researchProduct

Progress in the interpretation of near-field optics

1998

International audience

[PHYS.PHYS.PHYS-OPTICS] Physics [physics]/Physics [physics]/Optics [physics.optics]SURFACE-STRUCTURES[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics][ PHYS.PHYS.PHYS-OPTICS ] Physics [physics]/Physics [physics]/Optics [physics.optics]LIGHT CONFINEMENTSCATTERINGMICROSCOPYComputingMilieux_MISCELLANEOUSSCALE
researchProduct

Local detection of the optical magnetic field in the near zone of dielectric samples

2000

International audience; We present a study of the influence of the probe composition on the formation of constant-height photon scanning tunneling microscope images when observing a dielectric sample. Dramatic effects due to the metallization of the tip are presented and discussed in detail. We show how the recorded images can look quite different when the probe is dielectric or coated with gold. Comparison with numerical calculations indicate that the experimental signals are of electric or magnetic nature depending on the composition of the tip. For well-defined conditions, gold-coated tips provide images of the distribution of the magnetic field intensity associated with the optical near…

[PHYS.PHYS.PHYS-OPTICS] Physics [physics]/Physics [physics]/Optics [physics.optics]Scanning Hall probe microscopePhysics::OpticsNear and far field02 engineering and technologyDielectric01 natural sciencesOptics[ PHYS.COND.CM-MSQHE ] Physics [physics]/Condensed Matter [cond-mat]/Mesoscopic Systems and Quantum Hall Effect [cond-mat.mes-hall]0103 physical sciencesSCATTERING010306 general physicsPlasmon[PHYS.COND.CM-MSQHE]Physics [physics]/Condensed Matter [cond-mat]/Mesoscopic Systems and Quantum Hall Effect [cond-mat.mes-hall]PhysicsSURFACE-STRUCTURES[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics][ PHYS.PHYS.PHYS-OPTICS ] Physics [physics]/Physics [physics]/Optics [physics.optics]LIGHT CONFINEMENTbusiness.industryNear-field opticsMICROSCOPY021001 nanoscience & nanotechnology[PHYS.COND.CM-MSQHE] Physics [physics]/Condensed Matter [cond-mat]/Mesoscopic Systems and Quantum Hall Effect [cond-mat.mes-hall]Magnetic force microscope0210 nano-technologybusinessField ion microscopeExcitation
researchProduct

Manger confiné : quel impact sur nos habitudes alimentaires ?

2020

Il y a peu de temps, la population française vivait une période inédite : neuf semaines confinées à la maison. Des chercheurs du CSGA se sont intéressées à l'impact du confinement sur les habitudes alimentaires en déployant une vaste enquête auprès de 500 parents d'enfants de 3-11 ans.

alimentation[SDV.AEN] Life Sciences [q-bio]/Food and Nutritionpratiques éducativescomportement alimentaireconfinementquestionnaireenfant
researchProduct