Search results for "construct"

showing 10 items of 3723 documents

The Investment Performance of U.S. Islamic Mutual Funds

2020

Islamic investment funds have become increasingly important because of high demand from many investors, including those outside the Muslim investment community. This article compares the performance and risk sensitivity of Islamic mutual funds in the United States with that of their conventional peers. This article also analyzes the performance of Islamic funds, and compares this performance with that of socially responsible investment (SRI) mutual funds. Capital Asset Pricing Model (CAPM)-based methodology was used for the analysis. The results suggest that over the entire study period (1987&ndash

ethical investinglcsh:TJ807-830Geography Planning and Developmentlcsh:Renewable energy sourcesMonetary economicsManagement Monitoring Policy and Law:CIENCIAS ECONÓMICAS [UNESCO]Socially responsible investment0502 economics and businessEconomicsCapital asset pricing model050207 economicsInvestment performancelcsh:Environmental scienceslcsh:GE1-350050208 financeRenewable Energy Sustainability and the Environmentlcsh:Environmental effects of industries and plants05 social sciencesUNESCO::CIENCIAS ECONÓMICASIslamBuilding and Constructionislamic mutual fundsInvestment (macroeconomics)performance evaluationrisk-adjusted performancelcsh:TD194-195socially responsible investmentsSustainability
researchProduct

Etnia/etnicità

2015

Breve profilo sulla storia degli studi e sugli approcci teorici riguardanti i concetti di etnia e etnicità scritto specificamente come scheda di approfondimento per la seconda edizione riveduta di R. H. Robbins, Antropologia culturale. Un approccio per problemi (seconda edizione italiana a cura di G. D’Agostino e V. Matera), Novara, UTET Università Brief profile on the history of studies and theoretical approaches regarding the concepts of ethnicity and ethnicity written specifically as a background file for the second revised edition of R. H. Robbins, Cultural Anthropology. An approach to problems (second Italian edition edited by G. D'Agostino and V. Matera), Novara, UTET University

etnia etnicità primordialismo costruttivismo BarthSettore M-DEA/01 - Discipline Demoetnoantropologicheethnicity primordialism constructivism Barth
researchProduct

Experimental Analysis of the Thermal Performance of Wood Fiber Insulating Panels

2023

During the last decades, attention to energy and environmental problems has significantly grown, along with the development of international and national policies addressing sustainability issues. In the construction sector, one of the most widespread energy efficiency strategies consists of thermal insulation of buildings thanks to external insulating panels. Among these, wood fiber is an insulating material characterized by a natural, eco-sustainable and biodegradable structure, coming from the recycling of waste wood from sawmills. The present study aimed to characterize small test building insulated with wood fiber panels from the thermal point of view, comparing the results with those …

experimental campaignwood fiber sustainable materials sustainable building thermal behavior experimental campaignSettore ING-IND/11 - Fisica Tecnica Ambientalesustainable buildingwood fiberRenewable Energy Sustainability and the Environmentsustainable materialsGeography Planning and Developmentthermal behaviorBuilding and ConstructionManagement Monitoring Policy and Lawsustainable materialSustainability
researchProduct

Toward the Development of Load Transfer Efficiency Evaluation of Rigid Pavements by a Rolling Wheel Deflectometer

2020

The jointed rigid pavement is currently evaluated by the Falling weight deflectometer which is rather slow for the testing of the jointed pavements. Continuous nondestructive evaluation of rigid pavements with a rolling wheel deflectometer can be used to measure the load transfer and is investigated. Load transfer is an important indicator of the rigid pavement&rsquo

falling weight deflectometerComputer science0211 other engineering and technologies02 engineering and technologylcsh:TechnologyNondestructive testing021105 building & construction0502 economics and businesssemi-analytical modelGeneral Materials ScienceJoint (geology)Civil and Structural Engineering050210 logistics & transportationrolling wheel deflectometerlcsh:Tbusiness.industry05 social sciencesrigid pavementBuilding and ConstructionStructural engineeringGeotechnical Engineering and Engineering GeologyComputer Science ApplicationsContinuous dataFalling weight deflectometerTransfer efficiencyjointsload transferDevelopment (differential geometry)businessInfrastructures
researchProduct

Enquête sur l’atelier : histoire, fonctions, transformations

2014

Une stylisation de l’histoire de l’atelier d’artiste fait dependre ses fonctions du degre d’individualisation du travail createur, des innovations esthetiques et de l’economie de la production artistique. La periodisation qui suit fournit une trame sommaire. Indistinction entre art et artisanat d’abord : les ateliers sont situes dans les monasteres, dans les demeures des mecenes de la cour ou se confondent avec le domicile ou avec la boutique d’artisan en ville. Variabilite croissante des emp...

familleconstructionHistoryworkshopfamilyVisual Arts and Performing Artsfemmeart market[SHS]Humanities and Social SciencesatelierworkcréationcreationprofessionComputingMilieux_MISCELLANEOUSsociabilitéeducationchantiermétierformation[SHS.ART]Humanities and Social Sciences/Art and art historymarchépeintureapprentissagepaintingsociabilitytravail[SHS.ART] Humanities and Social Sciences/Art and art historycorporationwomen
researchProduct

Exploring identity construction in bilingual families

2017

Tämän pro gradu-tutkielman tarkoituksena on tarkastella kahden kaksikielisen perheen jäsenten identiteetin rakentumista. Vaikka kaksikielisyyttä perheissä on tutkittu laajalti, identiteetin rakentumisen näkökulmasta tutkimuksia on suhteellisen vähän. Tutkimus on luonteeltaan laadullinen ja tavoitteena oli selvittää miten perheenjäsenet kuvaavat identiteettiään ja identifioituvat kieliinsä sekä millaisia identiteettejä he rakentavat itselleen. Identiteettiin liittyen, tukielma halusi myös vastata kysymyksiin kielen käytöstä sekä tunteiden ilmaisemisesta. Tutkielma myös tarkastelee mahdollisia eroja ja yhtäläisyyksiä identiteettien välillä sukupolvien sekä sisarusten kesken. Lähtökohtana tutk…

familykaksikielisyysidentiteettiperhebilingualismidentity constructionidentity
researchProduct

Modeling the influence of potassium content and heating rate on biomass pyrolysis

2017

This study presents a combined kinetic and particle model that describes the effect of potassium and heating rate during the fast pyrolysis of woody and herbaceous biomass. The model calculates the mass loss rate, over a wide range of operating conditions relevant to suspension firing. The shrinking particle model considers internal and external heat transfer limitations and incorporates catalytic effects of potassium on the product yields. Modeling parameters were tuned with experimentally determined char yields at high heating rates (>200 K s−1) using a wire mesh reactor, a single particle burner, and a drop tube reactor. The experimental data demonstrated that heating rate and potassium …

fast pyrolysisParticle modelheating rate020209 energyPotassiumchemistry.chemical_elementBiomass02 engineering and technologyManagement Monitoring Policy and LawEnergy engineeringMetaplast0202 electrical engineering electronic engineering information engineeringmetaplastWaste managementpotassiumMechanical EngineeringHerbaceous biomassBuilding and ConstructionHeating ratePulp and paper industryKineticsGeneral EnergychemistrykineticsHeat transferPotassiumParticle sizePyrolysisFast pyrolysis
researchProduct

Exploiting Data Analytics and Deep Learning Systems to Support Pavement Maintenance Decisions

2021

Road networks are critical infrastructures within any region and it is imperative to maintain their conditions for safe and effective movement of goods and services. Road Management, therefore, plays a key role to ensure consistent efficient operation. However, significant resources are required to perform necessary maintenance activities to achieve and maintain high levels of service. Pavement maintenance can typically be very expensive and decisions are needed concerning planning and prioritizing interventions. Data are key towards enabling adequate maintenance planning but in many instances, there is limited available information especially in small or under-resourced urban road authorit…

feature importancepavement management systemComputer science0211 other engineering and technologiespavement maintenance decision02 engineering and technologypavement management systemslcsh:Technologylcsh:ChemistryGoods and services021105 building & construction0502 economics and business11. SustainabilitySettore ICAR/04 - Strade Ferrovie Ed AeroportiGeneral Materials Scienceroad asset databasesInstrumentationlcsh:QH301-705.5Fluid Flow and Transfer Processes050210 logistics & transportationbusiness.industryLevel of servicelcsh:TProcess Chemistry and TechnologyDeep learning05 social sciencesGeneral EngineeringPavement managementdeep learningTimelinedata mininglcsh:QC1-999Computer Science Applicationsroad asset databaseWorkflowRisk analysis (engineering)lcsh:Biology (General)lcsh:QD1-999lcsh:TA1-2040Key (cryptography)Settore ICAR/17 - DisegnoArtificial intelligencepavement maintenance decisionsbusinesslcsh:Engineering (General). Civil engineering (General)Predictive modellinglcsh:PhysicsApplied Sciences
researchProduct

Introduction to Mathematical Logic (Edition 2017)

2017

Hyper-textbook for students in mathematical logic, Edition 2017

first order logiclogicresolution methodpredicate logicMathematicsofComputing_GENERALresolutionintuitionistic logicHerbrand theorempropositional logicmodel theoryconstructive logicData_FILESComputingMilieux_COMPUTERSANDEDUCATIONnormal formsmathematical logicHardware_ARITHMETICANDLOGICSTRUCTUREScompleteness theorem
researchProduct

Periodontal health in a population with Parkinson's disease in Spain: a cross-sectional study.

2022

Background: The aim of this research is to evaluate the periodontal health of patients with Parkinson Disease (PD) in a Spanish cohort. Material and Methods: A cross-sectional study was performed on 104 patients with PD (mean age: 66.19+9.3 years) and 106 controls (mean age: 59.26+14.11 years). A pre-designed clinical protocol was implemented, which included a standardized epidemiological index for periodontal disease (CPITN), clinical attachment loss (CAL), tooth-loss, full mouth plaque index (FMPI), and oral hygienic habits. Univariate descriptions and comparative analysis were performed. Results: The majority of PD patients presented good oral hygienic habits. There were no significant d…

fixed positioning guide templateperiodontal diseaseoral hygieneParkinson Diseaseclinical attachment lossMiddle Agedanterolateral thigh perforator flapTooth LossCross-Sectional StudiesOtorhinolaryngologySpainParkinson’s diseaseHumansSurgerythree-dimensional printingPeriodontitisGeneral Dentistrycomputed tomography angiographyUNESCO:CIENCIAS MÉDICASreconstructive functional surgeryAgedMedicina oral, patologia oral y cirugia bucal
researchProduct