Search results for "ctv"

showing 10 items of 51 documents

Spread of Citrus tristeza virus in an area of Sicily.

2006

CTVspreadSettore AGR/12 - Patologia Vegetale
researchProduct

Citrus Tristeza Virus (CTV): A serious threat to the Italian citrus groves

2004

CTVSettore AGR/12 - Patologia Vegetale
researchProduct

ICTV Virus Taxonomy Profile : Finnlakeviridae

2020

Finnlakeviridae is a family of icosahedral, internal membrane-containing bacterial viruses with circular, single-stranded DNA genomes. The family includes the genus, Finnlakevirus, with the species, Flavobacterium virus FLiP. Flavobacterium phage FLiP was isolated with its Gram-negative host bacterium from a boreal freshwater habitat in Central Finland in 2010. It is the first described single-stranded DNA virus with an internal membrane and shares minimal sequence similarity with other known viruses. The virion organization (pseudo T=21 dextro) and major capsid protein fold (double-β-barrel) resemble those of Pseudoalteromonas phage PM2 (family Corticoviridae), which has a double-stranded …

taxonomysingle-stranded DNA phageviruksetvirusessystematiikka (biologia)flavobacterium phage FLiPICTV reportFinnlakeviridaebakteriofagiticosahedral membrane-containing virus
researchProduct

Insecure Firmware and Wireless Technologies as “Achilles’ Heel” in Cybersecurity of Cyber-Physical Systems

2022

In this chapter, we analyze cybersecurity weaknesses in three use-cases of real-world cyber-physical systems: transportation (aviation), remote explosives and robotic weapons (fireworks pyrotechnics), and physical security (CCTV). The digitalization, interconnection, and IoT-nature of cyber-physical systems make them attractive targets. It is crucial to ensure that such systems are protected from cyber attacks, and therefore it is equally important to study and understand their major weaknesses. peerReviewed

sulautettu tietotekniikkacybersecurityprotocolsasejärjestelmätilmailucyber-physical systemsfirmwaretakaisinmallinnusvideo surveillanceesineiden internetCCTVkyberturvallisuushaavoittuvuusvulnerabilitieswireless pyrotechnicsremote firing systemsexploitsvalvontajärjestelmätreverse engineeringZigbeeprotokollatcritical infrastructureaviationRFinfrastruktuuritbinareADS-B
researchProduct

La tristeza degli agrumi..

2012

Settore AGR/12 - Patologia VegetaleCTV dispersione
researchProduct

Distribution of three different isolates of Citrus Tristeza Virus in southern Italy

2010

CTV epidemiologySettore AGR/12 - Patologia Vegetale
researchProduct

Biopolitik am Computerbildschirm, in V. Borsò e M. Cometa (a cura) Die Kunst, das Leben zu Bewirtschaften. Biós zwischen Politik, Öikonomie und Äeste…

2013

Schermo bio-politica controllo sorveglianza Internet Era digitale Michel Foucault CCTV Panopticon
researchProduct

ICTV Virus Taxonomy Profile: Cystoviridae

2017

The family Cystoviridae includes enveloped viruses with a tri-segmented dsRNA genome and a double-layered protein capsid. The innermost protein shell is a polymerase complex responsible for genome packaging, replication and transcription. Cystoviruses infect Gram-negative bacteria, primarily plant-pathogenic Pseudomonas syringae strains. This is a summary of the International Committee on Taxonomy of Viruses (ICTV) Report on the taxonomy of the Cystoviridae, which is available at http://www.ictv.global/report/cystoviridae.

Cystoviridae0301 basic medicinebacteriophagesGenes Viralviruksetviruses030106 microbiologyGenome ViralVirus ReplicationGenomebakteriofagitICTVtaxonomy03 medical and health sciencesViral envelopeVirologyGram-Negative BacteriaPseudomonas syringaevirusesPseudomonas phage phi6PolymeraseVirus classificationbiologyta1183Bacteriophage phi 6VirologyICTV Virus Taxonomy Profiles3. Good health030104 developmental biologyCapsidViral replicationbiology.proteinPhageRNA ViralCapsid ProteinsJournal of General Virology
researchProduct

Citrus rootstock breeding: response of four allotetraploid somatic hybrids to Citrus tristeza virus induced infections

2018

Four allotetraploid somatic hybrids of citrus, with potential for rootstock improvement, have been evaluated for their response to Citrus tristeza virus (CTV) infection. CTV is the most important viral pathogen affecting citrus production worldwide. Somatic combinations of ‘Milam’ lemon (Citrus jambhiri Lush.) + Sour orange (C. aurantium L Osb.), Calamondin (C. madurensis Lour.) + ‘Keen’ sour orange (C. aurantium L.), Calamondin + ‘Femminello‘ lemon (C. limon L. Burm. F.) and Cleopatra mandarin (C. reshni Hort. ex Tan.) + ‘Femminello’ lemon, were studied. Plants were grafted with CTV-infected “Valencia” sweet orange budwood. Two different CTV strains collected in Sicily, considered as “mild…

0106 biological sciences0301 basic medicineReal-time qRT-PCRRT-PCRProtoplast fusionPlant ScienceOrange (colour)Horticulture01 natural sciencesMediterranean Basin03 medical and health sciencesstomatognathic systemGenotypeCitrus rootstockHybridRootstocksbiologyRough lemonSettore AGR/12 - Patologia VegetaleCitrus tristeza virusfood and beveragesbiology.organism_classificationCTV. Protoplast fusion . Rootstocks . DASELISA. RT-PCR . Real-time qRT-PCRHorticulture030104 developmental biologyCTVRootstockDAS-ELISAAgronomy and Crop Science010606 plant biology & botany
researchProduct

Variability Among Italian Citrus tristeza virus Isolates Revealed by SSCP Analysis, Cloning and Sequencing

2005

CloningGeneticsbiologySSCP analysisCTVSettore AGR/12 - Patologia VegetaleCitrus tristeza virusLife Sciencesbiology.organism_classificationSSCP
researchProduct