Search results for "ctv"

showing 10 items of 51 documents

Diffusione del virus della “Tristeza” degli agrumi (CTV) in aree agrumicole italiane

2006

diffusioneCTVSettore AGR/12 - Patologia Vegetale
researchProduct

WATCHING PEOPLE: ALGORITHMS TO STUDY HUMAN MOTION AND ACTIVITIES

2020

Nowadays human motion analysis is one of the most active research topics in Computer Vision and it is receiving an increasing attention from both the industrial and scientific communities. The growing interest in human motion analysis is motivated by the increasing number of promising applications, ranging from surveillance, human–computer interaction, virtual reality to healthcare, sports, computer games and video conferencing, just to name a few. The aim of this thesis is to give an overview of the various tasks involved in visual motion analysis of the human body and to present the issues and possible solutions related to it. In this thesis, visual motion analysis is categorized into thr…

human motionSettore ING-INF/05 - Sistemi Di Elaborazione Delle Informazionihuman actvity recognitionaction recognition360°360 cameradeep learningtracking 360°computer vision360° camerahuman behaviors segmentation360-degreepedestrian trackinghuman motion trackingtime serietime-serie
researchProduct

Incidence, distribution and diversity of Citrus tristeza virus in two different areas of Sicily

2007

incidenceCTVSettore AGR/12 - Patologia Vegetale
researchProduct

Genetic diversity and evolutionary analysis of Citrus Tristeza Virus p20 gene in Pakistan: insights into the spread and epidemiology

2016

Background: Citrus tristeza virus (CTV) is a widespread disease and the most destruction causing agent of citrus. Pakistan is ranked amongst the top ten citrus producing countries around the globe and it contributes about 2% to its foreign exchange earnings. Based on this assumption it is very important to monitor and determine the evolutionary forces and the phylogeography of Pakistani CTV population. Methods: A total of 49 sequences of p20 gene from Pakistan were phylogenetically compared with CTV sequences worldwide. These sequences were analyzed for their genetic diversity and evolution using a Bayesian Probability approach and predicted secondary structure. Results: Phylogenetic analys…

lcsh:Veterinary medicinelcsh:Biology (General)phylogenetic analysisCTV Bayesian probability phylogenetic analysis p20 geneCTVp20 genelcsh:SF600-1100Settore AGR/12 - Patologia Vegetalelcsh:QBayesian probabilitylcsh:Sciencelcsh:QH301-705.5
researchProduct

Towards CCTV-aware Routing and Navigation for Privacy, Anonymity, and Safety - Feasibility Study in Jyväskylä

2021

AbstractIn order to withstand the ever-increasing invasion of privacy by CCTV cameras and technologies, on par CCTV-aware solutions must exist that provide privacy, safety, and cybersecurity features. We argue that a first important step towards such CCTV-aware solutions must be a mapping system (e.g., Google Maps, OpenStreetMap) that provides both privacy and safety routing and navigation options. Unfortunately, to the best of our knowledge, there are no mapping nor navigation systems that support CCTV-privacy and CCTV-safety routing options. At the same time, in order to move the privacy vs. safety debate related to CCTV surveillance cameras from purely subjective to data-driven and evide…

safetyComputer sciencePrivacy laws of the United StatesContext (language use)PedestrianprivacyComputer securitycomputer.software_genrelcsh:TelecommunicationDomain (software engineering)anti-surveillancelcsh:TK5101-6720yksityisyyskameravalvontakarttapalvelutcctv-aware technologymappingnavigationreititysanonymityNavigation systemvalvontajärjestelmätcctvroutingsurveillanceRouting (electronic design automation)anonymiteettiScale (map)yksilönsuojacomputerAnonymity2021 28th Conference of Open Innovations Association (FRUCT)
researchProduct

Insecure Firmware and Wireless Technologies as “Achilles’ Heel” in Cybersecurity of Cyber-Physical Systems

2022

In this chapter, we analyze cybersecurity weaknesses in three use-cases of real-world cyber-physical systems: transportation (aviation), remote explosives and robotic weapons (fireworks pyrotechnics), and physical security (CCTV). The digitalization, interconnection, and IoT-nature of cyber-physical systems make them attractive targets. It is crucial to ensure that such systems are protected from cyber attacks, and therefore it is equally important to study and understand their major weaknesses. peerReviewed

sulautettu tietotekniikkacybersecurityprotocolsasejärjestelmätilmailucyber-physical systemsfirmwaretakaisinmallinnusvideo surveillanceesineiden internetCCTVkyberturvallisuushaavoittuvuusvulnerabilitieswireless pyrotechnicsremote firing systemsexploitsvalvontajärjestelmätreverse engineeringZigbeeprotokollatcritical infrastructureaviationRFinfrastruktuuritbinareADS-B
researchProduct

ICTV Virus Taxonomy Profile : Finnlakeviridae

2020

Finnlakeviridae is a family of icosahedral, internal membrane-containing bacterial viruses with circular, single-stranded DNA genomes. The family includes the genus, Finnlakevirus, with the species, Flavobacterium virus FLiP. Flavobacterium phage FLiP was isolated with its Gram-negative host bacterium from a boreal freshwater habitat in Central Finland in 2010. It is the first described single-stranded DNA virus with an internal membrane and shares minimal sequence similarity with other known viruses. The virion organization (pseudo T=21 dextro) and major capsid protein fold (double-β-barrel) resemble those of Pseudoalteromonas phage PM2 (family Corticoviridae), which has a double-stranded …

taxonomysingle-stranded DNA phageviruksetvirusessystematiikka (biologia)flavobacterium phage FLiPICTV reportFinnlakeviridaebakteriofagiticosahedral membrane-containing virus
researchProduct

ICTV Virus Taxonomy Profile: Sphaerolipoviridae 2023

2023

Members of the family Sphaerolipoviridae have non-enveloped tailless icosahedral virions with a protein-rich internal lipid membrane. The genome is a linear double-stranded DNA of about 30 kbp with inverted terminal repeats and terminal proteins. The capsid has a pseudo triangulation T=28 dextro symmetry and is built of two major capsid protein types. Spike complexes decorate fivefold vertices. Sphaerolipoviruses have a narrow host range and a lytic life cycle, infecting haloarchaea in the class Halobacteria (phylum Euryarchaeota). This is a summary of the International Committee on Taxonomy of Viruses (ICTV) Report on the family Sphaerolipoviridae, which is available at ictv.global/report/…

taxonomyviruksetsphaerolipoviridaesystematiikka (biologia)ICTV report
researchProduct

ICTV Virus Taxonomy Profile : Simuloviridae 2023

2023

The family Simuloviridae includes tailless icosahedral viruses with an internal lipid membrane. The capsid is constructed from two major capsid proteins, both with a single jelly-roll fold. The genome is a circular dsDNA molecule of 16–19 kb. All members infect halophilic archaea in the class Halobacteria (phylum Euryarchaeota) and are temperate viruses, their proviruses residing in host cells as extrachromosomal episomes. Once the lytic life cycle is triggered, production of virions causes cell lysis. This is a summary of the International Committee on Taxonomy of Viruses (ICTV) Report on the family Simuloviridae, which is available at ictv.global/report/simuloviridae. peerReviewed

taxonomyviruksetsystematiikka (biologia)simuloviridaeICTV report
researchProduct

CCTVCV: Computer Vision model/dataset supporting CCTV forensics and privacy applications

2022

The increased, widespread, unwarranted, and unaccountable use of Closed-Circuit TeleVision (CCTV) cameras globally has raised concerns about privacy risks for the last several decades. Recent technological advances implemented in CCTV cameras, such as Artificial Intelligence (AI)-based facial recognition and Internet of Things (IoT) connectivity, fuel further concerns among privacy advocates. Machine learning and computer vision automated solutions may prove necessary and efficient to assist CCTV forensics of various types. In this paper, we introduce and release the first and only computer vision models are compatible with Microsoft common object in context (MS COCO) and capable of accurately…

tekninen rikostutkintasovellukset (soveltaminen)datasetsobject detectiontekoälyprivacykameratcomputer visiontietosuojamachine learningkoneoppiminencamerasyksityisyyskameravalvontavideo surveillancekonenäköCCTVmappingkasvontunnistus (tietotekniikka)2022 IEEE International Conference on Trust, Security and Privacy in Computing and Communications (TrustCom)
researchProduct