Search results for "dialectic"

showing 10 items of 114 documents

Más allá del simulacro: redacción colaborativa de la E.D.U.S.I. del barrio del Cabanyal-Canyamelar-Cap de França (Valencia)

2016

El barrio del Cabanyal-Canyamelar-Cap de Franca es uno de los conjuntos urbanos mas destacables de la ciudad de Valencia. Un Plan parcial urbanistico promovido por el Ayuntamiento a finales de los noventa preveia alterar notablemente su morfologia, ante la posicion contraria de un vecindario que se movilizo y consiguio atenuar parte del impacto del plan. En una nueva etapa, el Ayuntamiento encarga una estrategia sostenible para el barrio que respete el patrimonio e incluya el punto de vista de los ciudadanos. Esa estrategia debera intentar recabar fondos europeos a traves de la convocatoria EDUSI del Ministerio de Fomento. El equipo Va Cabanyal gana el concurso para disenar esa estrategia o…

Técnicas dialécticasUrban planningSociologia urbanaPlanificación urbanaDialectical techniquesParticipación ciudadanaValenciaPublic participationCabanyalSociología
researchProduct

Alegoría barroca e imagen dialéctica: el esfuerzo de Walter Benjamin y Theodor W. Adorno para pensar la dialéctica de la naturaleza y la forma estéti…

2017

El artículo expone en la primera parte la concepción de la forma estética alegoría en El origen del drama barroco alemán de Walter Benjamin y el modo en que Adorno se apropia de esta concepción para construir su idea de historia natural. La segundaparte del artículo se centra en exponer la relación de las alegorías con las imágenes dialécticas de la Exposé de 1935 para La obra de los pasajes y la crítica constructiva que hace Adorno a las mismas en la Carta-Hornberg. El artículo pretende mostrar el esfuerzo común de ambos pensadores para abordar el problema de la forma estética y su relación con la dialéctica y la naturaleza.This article offers in the first part an exposition of the aesthet…

UNESCO::CIENCIAS DE LAS ARTES Y LAS LETRASAllegoryPhilosophy:CIENCIAS DE LAS ARTES Y LAS LETRAS [UNESCO]Dialectica interpretationHumanitiesLaocoonte. Revista de Estética y Teoría de las Artes
researchProduct

Visual Arguments in Film

2008

Nuestro objetivo es señalar algunas diferencias entre los argumentos verbales y visuales, y promover la perspectiva retórica de la argumentación, yendo más allá de la relevancia de la lógica y de la pragmática. En nuestra opinión, si ha de ser racional y aceptable como argumentación (visual), un film debe dirigirse a espectadores que tienen creencias informadas sobre el tema visto en la pantalla y sobre las limitaciones y las convenciones del medio. En nuestras reflexiones, aplicamos el análisis retórico al cine como un acto simbólico, humano y comunicativo que a veces puede entenderse como un argumento trazado visualmente. Como mezcla de estímulos visuales, auditivos y verbales, el film ex…

UNESCO::CIENCIAS DE LAS ARTES Y LAS LETRASLinguistics and Languagepragma-dialecticsPragma-dialecticsPerspective (graphical)Informal logicFilm theoryinformal logicargumentation theoryfilm theoryEpistemologyVisual rhetoricArgumentation theoryPhilosophyArgumentaudience:CIENCIAS DE LAS ARTES Y LAS LETRAS [UNESCO]argumento visualRhetorical questionSociology:LÓGICA [UNESCO]pragmaticsvisual rhetoricUNESCO::LÓGICAArgumentation
researchProduct

La idea de tradición en la estética de Jan Mukarovsky

2017

El presente artículo rastrea el uso de la idea de tradición en la estética de Jan Mukarovsky. Dicha idea no aparece entre sus principales conceptos, pero su identificación con la idea de estructura la coloca en un lugar prominente para captar el aspecto social y dinámico de los hechos estéticos y artísticos. A través del análisis de los hitos más significativos de la obra de Mukarovsky –la estructura, la norma, el valor, la función estética, el objeto estético, la recepción y la intencionalidad–, se alumbra una noción de tradición viva como proceso estructural desde el cual comprender los cambios históricos en las prácticas artísticas. A partir de ahí, es posible establecer una dialéctica e…

UNESCO::CIENCIAS DE LAS ARTES Y LAS LETRASPhilosophyIntentionality:CIENCIAS DE LAS ARTES Y LAS LETRAS [UNESCO]Dialectica interpretationHumanities
researchProduct

Agency in the Space of Reasons. A comment on *The Castle*

2021

The received view regards the agent's experience and the external world as split by an unsurmountable metaphysical gulf; while an agent's desires belong to the inner and motivate her to act in one or another way, the outer is presented as a domain deprived of any evaluative properties. *In the Retrieval of Ethics*, Talbot Brewer argues that we can hardly make sense of our agency if the inner and the outer are thus kept apart, since an agent's motivations must be sensitive to the good and the good must be placed on the outside; it must be experienced as something she confronts. In this paper, I will stress that, in *The Castle*, there is no way in which K. might succeed in separating the inn…

UNESCO::FILOSOFÍA::Antropología filosófica::Filosofía de la acciónagencydialectical activityreasonsconversation:FILOSOFÍA::Antropología filosófica::Filosofía de la acción [UNESCO]
researchProduct

Zone of Proximal Development (ZPD) as an Emergent System: A Dynamic Systems Theory Perspective

2016

This paper sets out to present a novel construal of one of the notions of Vygotskian cultural-historical theory viz., zone of proximal development (ZPD) drawing upon dynamic systems theory. The principal thesis maintains that ZDP is an emergent and dynamic system which is engendered by a dialectical concatenation of psychogenesic and sociogenesic facets of human development over time. It is reasoned that Vygotskian cultural-historical theory of human development, by invoking dialectical logic, has transcended Cartesian substance dualism and in turn has proffered a monistic and process-anchored ontology for emerging becoming of human consciousness. Likewise, it is contended that dynamic syst…

ZPDCultural StudiesSocial PsychologyZone of proximal developmentHuman Developmentmedia_common.quotation_subjectCultureSystems Theory050109 social psychologydynamic systems theoryHumans0501 psychology and cognitive sciencesSociologyConsilienceApplied PsychologyAxiommedia_commonVygotskian cultural-history theoryDialecticdialectical logicCommunication05 social sciencesDialectical logicemergenssiEpistemologyPhilosophyAnthropologyOntologyConstrual level theoryzone of proximal developmentConsciousnessPsychological Theory050104 developmental & child psychologyIntegrative Psychological and Behavioral Science
researchProduct

Integrative thinking is the key : An evaluation of current research into the development of adult thinking

2011

Post-formal relativistic-dialectical thinking has been widely claimed to be a new developmental stage of intellectual development. Other theoretical models come very close to post-formal thinking, with overlapping features such as the study of wisdom and epistemic understanding, as well as models of expertise, critical thinking, and scepticism. No coherent theory exists in the fields of post-formal and relativistic-dialectical thinking, though scholars have claimed that there is some similarity between the models. While empirical evidence of interconnectedness between them exists, a major difficulty lies in the theoretical definition of concepts. We critically assess the definitions of rela…

adult developmentdevelopment of thinkingtheoretical analysisintegrative thinkingpost-formal thinkingrelativistic-dialectical thinkingepistemic understandingwisdom
researchProduct

Henkilön psykiatria : psykiatrian dialektinen filosofia

2017

The Finnish word ’henkilö’ is difficult to translate in English as a ‘Person’, but in international plan-language, Esperanto, we can quite exactly translate it as ‘spiritulo’. The word henkilö, spiritulo, is developed in the 19th century from the ancient Finnish word ‘henki’ by the medical doctor in Jyväskylä region Wolmar Schildt-Kilpinen. He was not satisfied with the simple translation from Latin word ‘persona’ to Finnish ‘persoona’, and so via the ancient word he conceptually combined the spiritulo to the dialectical process of negation of negation of the ethnic culture – elite culture – national culture. So the spiritulo could express the community (Gemeinschaft) and common (gemein) at…

akuuttihoitopersonpsychiatric treatmentpsychiatric rehabilitationmaailmankuvapersoonaworld viewethicspsychiatrydialecticshenkilötpsykiatriapsykiatrinen hoitopsykiatrinen kuntoutusetiikkasubjectsubjekti (filosofia)dialektiikka
researchProduct

A NEW DIALETICS CENTRE/PERIPHERY: CONSUMPTION PATTERNS AND PRACTICES IN THE SUBURBAN AREAS

2014

This paper deals with the analysis of current changes which have been recently shaping unprecedented urban structures in some suburban areas, due to the emerging of new consumptions spaces. In particular, the work aims at highlighting the effect of urban sprawl on the main Sicilian metropolitan areas, also moulded by the diffusion of the suburban retailing formats, in order to evaluate to what extent these dynamics have been contributing to the configuration of new urban landscapes and unprecedented socio-economic structures, not to mention the support in the process of containing social and economic marginalisation.

centre-periphery dialecticsSettore M-GGR/02 - Geografia Economico-Politicaperiphery dialecticsurban sprawlconsumption spaces ; periphery dialectics ; urban sprawlcitynew consumption spaces centre-periphery dialectics urban sprawl city SicilySettore M-GGR/01 - GeografiaSicilynew consumption spacesconsumption spaces
researchProduct

Long-Term Efficacy of Psychosocial Treatments for Adults With Attention-Deficit/Hyperactivity Disorder: A Meta-Analytic Review

2018

Background: Recent evidence suggests that psychosocial treatments, particularly cognitive-behavioral therapy (CBT), are effective interventions for adult attention deficit hyperactivity disorder (ADHD). The objective of this review was to determine the long-term efficacy of psychosocial interventions in improving clinically relevant variables, including ADHD core symptoms, clinical global impression (CGI), and global functioning. Methods: In total, nine randomized controlled trials and three uncontrolled single-group pretest-posttest studies were included. The data from these studies were combined using the inverse variance method. Heterogeneity and risk of bias were assessed. Subgroup anal…

cognitive-behavioral therapymedicine.medical_treatmentlcsh:BF1-990Teràpia de la conductaImpulsivitylaw.invention03 medical and health sciences0302 clinical medicineRandomized controlled triallawmedicineAttention deficit hyperactivity disorderPsychologypsychosocial treatmentGeneral Psychologydialectical-behavior therapyOriginal ResearchConducta (Psicologia)medicine.diseaseDialectical behavior therapy030227 psychiatryCognitive behavioral therapymeta-analysislong-term efficacylcsh:PsychologyMeta-analysisadult ADHD treatmentClinical Global Impressionmedicine.symptommindfulness-based cognitive therapyPsychologyPsychosocial030217 neurology & neurosurgeryClinical psychologyFrontiers in Psychology
researchProduct