Search results for "efficacy"

showing 10 items of 588 documents

Pepsinogen testing for evaluation of the success of Helicobacter pylori eradication at 4 weeks after completion of therapy.

2014

Background and objective: Pepsinogen levels in plasma are increased by inflammation in the gastric mucosa, including inflammation resulting from Helicobacter pylori infection. A decrease in pepsinogen II level has been suggested as a reliable marker to confirm the successful eradication of infection. The aim of our study was to evaluate the potential role of pepsinogens I and II, gastrin-17 and H. pylori antibodies in confirming successful eradication. Material and methods: Altogether 42 patients (25 women, 17 men), mean age 45 years (range 23–74), were enrolled. Pepsinogens I and II, gastrin-17 and H. pylori IgG antibodies were measured in plasma samples using an ELISA test (Biohit, Oyj., …

AdultMalemedicine.medical_specialtyHelicobacter pylori infectionEfficacyGastrin-17macromolecular substancesPepsinogenGastroenterologydigestive systemHelicobacter InfectionsYoung AdultAtrophyPepsinInternal medicinePepsinogen AGastrinsmedicineGastric mucosaPepsinogen CHumansEradicationAgedMedicine(all)lcsh:R5-920biologyPlasma samplesHelicobacter pyloribusiness.industryHelicobacter pyloriMiddle Agedbiology.organism_classificationmedicine.diseaseAntibodies Bacterialdigestive system diseasesmedicine.anatomical_structureTreatment OutcomeGastric MucosaAutomotive Engineeringbiology.proteinPepsinogen IIPepsinogen; Gastrin-17; Eradication; <em>Helicobacter pylori</em>; EfficacyFemaleAntibodybusinesslcsh:Medicine (General)<em>Helicobacter pylori</em>BiomarkersMedicina (Kaunas, Lithuania)
researchProduct

Improved effectiveness from individualized dosing of self-administered biologics for the treatment of moderate-to-severe psoriasis: a 5-year retrospe…

2019

Background: Biologics for moderate-to-severe psoriasis are expensive and treatment substitutions may vastly increase cost. Moreover, administration regimens in routine practice may differ from recommended guidelines. Objectives: To evaluate long-term effectiveness, regimen, drug-survival, and efficiency of self-administered biologics in clinical practice. Methods: We performed a 5-year retrospective study in 72 patients (44 ± 14 years old) with moderate-to-severe psoriasis at the University Hospital La Plana (Vila-real, Spain), treated with subcutaneous biologics. We determined the effectiveness (PASI 75 or PASI < 5), and drug-survival using Kaplan-Meier estimates, and analyzed reasons for …

AdultMalemedicine.medical_specialtyIndividualized dosingCost effectivenessefficacySelf AdministrationKaplan-Meier EstimateDermatologyRoutine practiceDrug CostsustekinumabEtanercept030207 dermatology & venereal diseases03 medical and health sciences0302 clinical medicineChart reviewPsoriasisUstekinumabmedicineHumansPsoriasisbiologicsIntensive care medicinecost-effectivenessRetrospective Studies030203 arthritis & rheumatologyBiological ProductsDrug Substitutionbusiness.industryModerate to severe psoriasisAdalimumabpsoriasisanti-TNFpersistenceMiddle Agedmedicine.diseaseUniversity hospitalSpainFemaleUstekinumabbusinessmedicine.drugJournal of Dermatological Treatment
researchProduct

Alemtuzumab treatment of multiple sclerosis in real-world clinical practice: A report from a single Italian center

2020

Abstract Background Alemtuzumab, is a compound approved for highly active MS, and, in Europe, employed after the use of other disease-modifying treatments (DMTs) with an escalation approach or used as a first therapeutic option. The occurrence of secondary autoimmune adverse events and or infections can differ depending on the employed approach. Objective To evaluate the efficacy and safety of alemtuzumab in real-world MS population that encompassed patients previously treated with other DMTs. Methods 35 patients, treated with alemtuzumab in a single MS Center, were followed for at least 36 months. The study investigated the prevalence of patients reaching the phase of the non-active diseas…

AdultMalemedicine.medical_specialtyMultiple SclerosisEfficacyPopulationDisease03 medical and health sciences0302 clinical medicineInternal medicinePost-hoc analysisOutcome Assessment Health CaremedicineHumansImmunologic Factors030212 general & internal medicineAdverse effecteducationAlemtuzumabeducation.field_of_studybusiness.industryMultiple sclerosisGeneral MedicineMiddle Agedmedicine.diseasePancytopeniaProgression-Free SurvivalNeurologyItalyAdverse eventsDisease ProgressionAlemtuzumabFemaleSettore MED/26 - NeurologiaNeurology (clinical)Autoimmune hemolytic anemiaSafetybusiness030217 neurology & neurosurgerymedicine.drugFollow-Up Studies
researchProduct

Efficacy of different rituximab therapeutic strategies in patients with neuromyelitis optica spectrum disorders

2019

Abstract Objective To evaluate disease activity according to rituximab (RTX) induction and maintenance regimens in a multicenter real-life dataset of NMOSD patients. Methods This is an observational-retrospective multicentre study including patients with NMOSD treated with RTX in 21 Italian and 1 Swiss centers. Demographics, relapse rate and adverse events over the follow-up were summarized taking into account induction strategy (two-1 g infusions at a 15-day interval (IND-A) vs. 375 mg/m2/week infusions for one month (IND-B)) and maintenance therapy (regimen A (M-A) with fixed time-points infusions vs. regimen B (M-B) based on cytofluorimetric driven reinfusion regimens, the least further …

AdultMalemedicine.medical_specialtyMultivariate analysisEfficacyOutcome and Process AssessmentSettore MED/2603 medical and health sciences0302 clinical medicineMaintenance therapyInternal medicinemedicineHumansImmunologic FactorsIn patient030212 general & internal medicineAdverse effectAgedRetrospective StudiesNeuromyelitis opticabusiness.industryMultiple sclerosisGeneral MedicineMiddle Agedmedicine.diseaseNeuromyelitis opticaHealth CareRegimenOutcome and Process Assessment Health CareNeurologyEfficacy Neuromyelitis optica RituximabRituximabFemaleNeurology (clinical)businessRituximab030217 neurology & neurosurgerymedicine.drugFollow-Up Studies
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

My Well-Being in My Own Hands: Experiences of Beneficial Recovery During Burnout Rehabilitation.

2015

Purpose To explore how burnout rehabilitation clients experienced their recovery from burnout and what they found beneficial in rehabilitation. Subjects Twelve clients whose burnout levels had declined during rehabilitation were interviewed at the end of the second period of the rehabilitation course. Methods Semi-structured interviews comprised the main material of the study and were analysed by content analysis. In addition, the Bergen Burnout Indicator (BBI-15) was used to measure the reduction in burnout levels. Results The analysis yielded a single overarching theme, Mywell-being in my own hands, and four categories. The overarching theme describes the overall process of recovery and t…

AdultMalemedicine.medical_treatmenteducationHappinessmuutosBurnoutOccupational safety and healthInterviews as TopicOccupational TherapymedicineHumansPerceived controlBurnout ProfessionalOccupational HealthQualitative ResearchRehabilitationtyöterveysRehabilitationinterviewSocial SupportAwarenessMiddle AgedSelf EfficacysisällönanalyysiHealth psychologyAttitudeContent analysisWell-beingFemalekvalitatiivinen tutkimusPsychologyClinical psychologyQualitative researchJournal of occupational rehabilitation
researchProduct

Clinical outcomes and safety of rituximab treatment for patients with systemic lupus erythematosus (SLE) – results from a nationwide cohort in German…

2013

Objective The objective of this article is to evaluate the safety and clinical outcome of rituximab treatment in systemic lupus erythematosus (SLE) patients refractory to standard of care therapy in a real-life setting in Germany. Methods The GRAID registry included patients with different autoimmune diseases who were given off-label treatment with rituximab. Data on safety and clinical response were collected retrospectively. In SLE patients, clinical parameters included tender and swollen joint counts, fatigue, myalgia, general wellbeing, Raynaud’s and the SLEDAI index. Laboratory tests included dsDNA antibody titres, complement factors, hematologic parameters and proteinuria. Finally, th…

AdultMalemyalgiamedicine.medical_specialty610 MedizinCohort StudiesAntibodies Monoclonal Murine-DerivedRheumatologyRefractoryInternal medicineHumansLupus Erythematosus SystemicMedicineIn patientskin and connective tissue diseasesRetrospective Studiesddc:610Proteinuriabusiness.industryOff-Label UseSystemic lupus erythematosus; rituximab; efficacy; safety;Blymphocytes; cohort studiesDiscontinuationCohortPhysical therapyFemaleRituximabmedicine.symptomRituximabbusinessCohort studymedicine.drugLupus
researchProduct

Double-blind, randomized, placebo-controlled trial of allergen-specific immunotherapy with the major allergen Alt a1

2019

Background: There have been few studies conducted on the efficacy and safety of specific immunotherapy with allergen extracts of fungi compared with other allergen extracts, and there are no data on the major allergen Alt a 1 of the fungus Alternaria alternata. Objectives: We sought to evaluate the efficacy and safety of subcutaneous immunotherapy with 2 different doses of Alt a 1 in patients with rhinoconjunctivitis caused by sensitization to A alternata. Method: We performed a multicenter, randomized, double-blind, placebo-controlled trial with Alt a 1 administered subcutaneously in patients with allergic rhinoconjunctivitis with or without controlled asthma aged 12 to 65 years. Three gro…

AdultMalesafetyAllergymedicine.medical_specialtyAllergen immunotherapyAl·lèrgiaAdolescentImmunologyefficacyPlacebo-controlled studyPlacebomedicine.disease_causeFungal ProteinsYoung AdultAllergenDouble-Blind Methodchildrensubcutaneous immunotherapyInternal medicinemedicineadultsImmunology and AllergyHumansmolecular immunotherapyAdverse effectChildAgedConjunctivitis AllergicAllergen immunotherapyIntention-to-treat analysisbusiness.industryrhinoconjunctivitisclinical trialAllergensImmunoglobulin EMiddle Agedmedicine.diseaseAsthmaClinical trialfungal allergyDesensitization ImmunologicImmunoglobulin GAlt a 1Femalebusinesspurified allergen
researchProduct

Second-line Eribulin in Triple Negative Metastatic Breast Cancer patients. Multicentre Retrospective Study: The TETRIS Trial

2021

Introduction: Large and consistent evidence supports the use of eribulin mesylate in clinical practice in third or later line treatment of metastatic triple negative breast cancer (mTNBC). Conversely, there is paucity of data on eribulin efficacy in second line treatment. Methods: We investigated outcomes of 44 mTNBC patients treated from 2013 through 2019 with second line eribulin mesylate in a multicentre retrospective study involving 14 Italian oncologic centres. Results: Median age was 51 years, with 11.4% of these patients being metastatic at diagnosis. Median overall survival (OS) and progression free survival (PFS) from eribulin starting were 11.9 (95%CI: 8.4-15.5) and 3.5 months (95…

AdultOncologyEribulin Mesylatemedicine.medical_specialtyeribulin mesylatemedicine.medical_treatmentTriple Negative Breast Neoplasmschemotherapytriple negative metastatic breast cancer03 medical and health scienceschemistry.chemical_compound0302 clinical medicineadjuvantInternal medicineAntineoplastic Combined Chemotherapy Protocols80 and overmedicineHumansChemotherapy; Efficacy outcomes; Eribulin mesylate; Toxicity outcomes; Triple negative metastatic breast cancerProgression-free survivalFuransAdverse effectTriple-negative breast cancerAgedNeoplasm StagingRetrospective StudiesAged 80 and overChemotherapybusiness.industryRetrospective cohort studyGeneral MedicineKetonesMiddle Agedmedicine.diseaseMetastatic breast cancerNeoadjuvant TherapyProgression-Free SurvivalchemistryChemotherapy AdjuvantFemale030211 gastroenterology & hepatologytoxicity outcomesefficacy outcomeschemotherapy; efficacy outcomes; eribulin mesylate; toxicity outcomes; triple negative metastatic breast cancer; adult; aged; aged; 80 and over; antineoplastic combined chemotherapy protocols; chemotherapy; adjuvant; female; furans; humans; ketones; middle aged; neoadjuvant therapy; neoplasm staging; progression-free survival; retrospective studies; triple negative breast neoplasmsbusinessResearch PaperEribulinInternational Journal of Medical Sciences
researchProduct

Metronomic chemotherapy for advanced breast cancer patients in the real world practice: Final results of the VICTOR-6 study

2019

Abstract Metronomic chemotherapy (mCHT) refers to the minimum biologically effective dose of a chemotherapy agent given as a continuous dosing regimen, with no prolonged drug-free breaks, that leads to antitumor activity. Aim of the present study is to describe the use of mCHT in a retrospective cohort of metastatic breast cancer (MBC) patients in order to collect data regarding the different types and regimens of drugs employed, their efficacy and safety. Between January 2011 and December 2016, data of 584 metastatic breast cancer patients treated with mCHT were collected. The use of VRL-based regimens increased during the time of observation (2011: 16.8% - 2016: 29.8%), as well as CTX-bas…

AdultOncologymedicine.medical_specialtyCyclophosphamideSettore MED/06 - Oncologia MedicaAntineoplastic AgentsBreast NeoplasmsVinorelbineDrug Administration ScheduleAntineoplastic AgentEfficacyCapecitabine03 medical and health sciencesBreast cancer0302 clinical medicineBreast cancerRetrospective StudieInternal medicineAntineoplastic Combined Chemotherapy ProtocolsmedicineHumans030212 general & internal medicineProgression-free survivalCyclophosphamideRetrospective StudiesAgedAged 80 and overAntineoplastic Combined Chemotherapy Protocolbusiness.industryMetronomic chemotherapyVinorelbineGeneral MedicineMiddle Agedmedicine.diseaseMetastatic breast cancerMetronomic ChemotherapySurvival RateMethotrexateTreatment Outcome030220 oncology & carcinogenesisMED/06 - ONCOLOGIA MEDICAFemaleSurgerybusinessBreast NeoplasmHumanmedicine.drugThe Breast
researchProduct