Search results for "fen"

showing 10 items of 3710 documents

Switching spatial scale reveals dominance-dependent social foraging tactics in a wild primate

2017

When foraging in a social group, individuals are faced with the choice of sampling their environment directly or exploiting the discoveries of others. The evolutionary dynamics of this trade-off have been explored mathematically through the producer-scrounger game, which has highlighted socially exploitative behaviours as a major potential cost of group living. However, our understanding of the tight interplay that can exist between social dominance and scrounging behaviour is limited. To date, only two theoretical studies have explored this relationship systematically, demonstrating that because scrounging requires joining a competitor at a resource, it should become exclusive to high-rank…

resource defenceproducer-scroungersocial dominanceresource ecologyphenotype-limited strategypaviaanitindividual differencescompetitionsocial foragingeläinten käyttäytyminen
researchProduct

A la recherche du principe d'égalité dans l'arbitrage commercial international

2008

International audience

respect du principe par la convention d'arbitrageégalité et respect des droits de la défense[SHS.DROIT]Humanities and Social Sciences/Law[SHS.DROIT] Humanities and Social Sciences/LawEgalité des parties dans la constitution du tribunal arbitralrespect du principe par le juge du contrôle de l'arbitrageégalité et principe de collégialitéégalité des parties dans l'instance arbitraleautonomie du principe d'égalitéComputingMilieux_MISCELLANEOUS[ SHS.DROIT ] Humanities and Social Sciences/Lawrespect du principe par les institutions d'arbitrage
researchProduct

The Unseen, the Discouraged, and the Outcast : Expressivity and the Foundations of Social Recognition

2018

AbstractThis article analyzes different pathologies of social affirmation and examines the grounds of social recognition from the point of view of the concept of expression. The red thread of the text is provided by Tove Jansson’s fictional works, and the focus will be on three cases in particular (the magic hat, the invisible girl and the figure of the Groke). The article sets out from the phenomenological distinction between the sensible expression, on the one hand, and the expressed content, on the other. By focusing on the three cases, the article distinguishes and analyses the fundamental structures of communal life and explicates different ways in which social affirmation can be one-s…

responsiveness050108 psychoanalysismuumitkehityspsykologiaPhenomenology (philosophy)03 medical and health sciences0302 clinical medicineexpression0501 psychology and cognitive sciencesExpressivity (genetics)psykoanalyysiprojektio (mallinnus)theory of recognition05 social sciencesfenomenologiasyrjäytyminenSocial recognition030227 psychiatrysosiaaliset suhteetPhilosophyilmaisuExpression (architecture)AestheticsTove JanssonulkopuolisuusJansson ToveSocial exclusionPsychologysocial affirmationthe Moomin
researchProduct

Séminaire d'actualisation des connaissances des auditeurs de l'IHEDN des 22 et 23 juin 2007 : "la dangerosité du monde"

2007

ressources[SHS.DROIT]Humanities and Social Sciences/Law[SHS.DROIT] Humanities and Social Sciences/LawRussiemondechangement de climatpopulationgestion des catastrophes naturellesplanification et programmation de la Défenseréchauffement climatiqueChine[ SHS.DROIT ] Humanities and Social Sciences/Lawdangerosité
researchProduct

Measuring phenotypes in fluctuating environments

2020

Despite considerable theoretical interest in how the evolution of phenotypic plasticity should be shaped by environmental variability and stochasticity, how individuals actually respond to these aspects of the environment within their own lifetimes remains unclear. We propose that this understanding has been hampered by experimental approaches that expose organisms to fluctuating environments (typically treatments where fluctuations in the environment are cyclical vs. erratic) for a pre‐determined duration, while ensuring that the mean environment over that the entire exposure period is invariable. This approach implicitly assumes that responses to the mean and variance/predictability in th…

reversible plasticitylämmönsietofungiunpredictable environmentsvesikirputheat tolerancefenotyyppivaihtelulämpötilabet-hedgingthermal toleranceympäristönmuutoksetinsurance
researchProduct

Acclimation capacity and rate change through life in the zooplankton Daphnia

2020

When a change in the environment occurs, organisms can maintain an optimal phenotypic state via plastic, reversible changes to their phenotypes. These adjustments, when occurring within a generation, are described as the process of acclimation. While acclimation has been studied for more than half a century, global environmental change has stimulated renewed interest in quantifying variation in the rate and capacity with which this process occurs, particularly among ectothermic organisms. Yet, despite the likely ecological importance of acclimation capacity and rate, how these traits change throughout life among members of the same species is largely unstudied. Here we investigate these rel…

reversible plasticitysopeutuminenakklimatisaatiolämmönsietoallometryvesikirputheat tolerancefenotyyppibody sizethermal toleranceympäristönmuutokset
researchProduct

Alfrēda Zirnīša vēsturisko fenoloģisko novērojumu datu bāzes izveide un fenoloģiskais raksturojums Latvijā (1926–1940)

2022

Vēsturisko fenoloģisko datu kopu analīzei ir liela nozīme klimatisko pārmaiņu ietekmes raksturošanai uz ekosistēmām pētniecībā. Izpratne par ietekmes procesiem dod iespēju tautsaimniecības nozares speciālistiem priekšlaicīgi sagatavoties jeb izstrādāt adaptācijas scenārijus. Bakalaura darba mērķis ir, balstoties uz Alfrēda Zirnīša apkopotiem, vēsturiskiem fenoloģiskajiem datiem, veikt fenoloģisko raksturojumu un izvērtēt reģionālās izmaiņas Latvijā laika posmā no 1926 – 1940. gadam. Fenoloģiskais raksturojums ir veikts trīs fenoloģiskām fāzēm un piecām sugām, kur rezultātā tika iegūts, ka augšanas sezona vidēji ilgst 131 dienu, un reģionālās atšķirības fāzēm ir atšķirīgas, kā arī tika izvei…

reģionālās izmaiņasĢeogrāfijadigitalizēšanafenoloģiskās fāzesvēsturiskie dati
researchProduct

Metabotropic glutamate receptors activate phospholipase D in astrocytes through a protein kinase C-dependent and Rho-independent pathway.

2003

Metabotropic glutamate receptors (mGluRs) are G protein-coupled receptors that mediate phospholipase D (PLD) activation in brain, but the mechanism underlying this response remains unclear. Here we used primary cultures of astrocytes as a cell model to explore the mechanism that links mGluRs to PLD. Glutamate activated both phospholipase C (PLC) and PLD with equal potency and this effect was mimicked by L-cysteinesulfinic acid, a putative neurotransmitter previously shown to activate mGluRs coupled to PLD, but not PLC, in adult brain. PLD activation by glutamate was dependent on Ca(2+) mobilization and fully blocked by both protein kinase C (PKC) inhibitors and PKC down-regulation, suggesti…

rho GTP-Binding ProteinsIndolesBacterial ToxinsGlutamic AcidBiologyReceptors Metabotropic GlutamateSulfenic AcidsMaleimidesRats Sprague-DawleyCellular and Molecular NeuroscienceBacterial ProteinsStress FibersmedicinePhospholipase DAnimalsCysteineEgtazic AcidProtein kinase CCells CulturedProtein Kinase CChelating AgentsPharmacologyProtein Synthesis InhibitorsBrefeldin APhospholipase CDose-Response Relationship DrugEndothelin-1Phospholipase DADP-Ribosylation FactorsMetabotropic glutamate receptor 6Glutamate receptorDNAMolecular biologyRatsenzymes and coenzymes (carbohydrates)medicine.anatomical_structureMetabotropic receptorMetabotropic glutamate receptorAstrocytesType C PhospholipasesTetradecanoylphorbol Acetatelipids (amino acids peptides and proteins)AstrocyteNeuropharmacology
researchProduct

Lo stupore fenomenologico e l’evento educativo

2013

riduzioneFenomenologiaevidenza.Settore M-PED/01 - Pedagogia Generale E Sociale
researchProduct

Phenomenological Strands for Gaming Disorder and Esports Play: A Qualitative Registered Report

2021

The recent inclusion of gaming disorder in the ICD-11 as a mental disorder has further increased the importance of researching the health spectrum related to gaming. A critical area in this regard is the lack of clarity concerning the differences between gaming disorder and intensive play, the latter of which often involves several gaming hours per day without related health problems. In this study, we approached the above question by interpretive phenomenological analysis with interviews in two groups of highly involved videogame players: those who seek or have sought clinical help for their problems with gaming (n=6), and those who play esports more than 4 hours per day without self-repor…

riippuvuusvideopelitfenomenologiaongelmapelaaminenterveysaddiktiivisuuspsykopatologia
researchProduct