Search results for "fononit"

showing 7 items of 17 documents

Specific heat of thin phonon cavities at low temperature: Very high values revealed by zeptojoule calorimetry

2022

The specific heat of phonon cavities is investigated in order to analyze the effect of phonon confinement on thermodynamic properties. The specific heat of freestanding very thin SiN membranes in the low-dimensional limit is measured down to very low temperatures (from 6 K to 50 mK). In the whole temperature range, we measured an excess specific heat orders of magnitude bigger than the typical value observed in amorphous solids. Below 1 K, a crossover in cp to a lower power law is seen, and the value of the specific heat of thinner membranes becomes larger than that of thicker ones demonstrating a significant contribution coming from the surface. We show that this high value of the specific…

kylmäfysiikkananorakenteetCondensed Matter - Mesoscale and Nanoscale PhysicstermodynamiikkaMesoscale and Nanoscale Physics (cond-mat.mes-hall)FOS: Physical scienceskalorimetriaohutkalvotfononitPhysical Review B
researchProduct

Application of time-dependent many-body perturbation theory to excitation spectra of selected finite model systems

2016

In this thesis, an approximate method introduced to solve time-dependent many-body problems known as time-dependent many-body perturbation theory is studied. Many-body perturbation theory for interacting electrons and phonons is reviewed. In particular, the electron propagator G and an unconventional two-component phonon propagator, which satisfy coupled integral Dyson equations, are introduced. In practice, the associated integral kernels known as the electron Σ and phonon self-energies need to be approximated. The conserving approximations known as the Hartree (-Fock) and the first and second Born approximations, which respect the continuity equation between the electron density and curren…

numeeriset menetelmätmany-body problemsmany-body theoryspektroskopiaGreenin funktioGreen's functionmonen kappaleen teoriaelektronittime-dependent many-body perturbation theoryaikariippuva monihiukkashäiriöteoriaelectron-phonon interactionkiinteän olomuodon fysiikkakvanttimekaniikkaexcitation spectraapproksimointifononit
researchProduct

Fabrication of 3-D phononic crystals for thermal transport management

2016

Thermal transport is an important physical phenomenon, and it has recently become even more relevant for the reduction of energy losses and the increase of efficiency in novel devices based on thermoelectricity [1]. Significant reduction of thermal conduction was recently achieved by coherent modification of phonon modes [2], with the help of periodic phononic crystal structures. However, currently the experimental studies have only been performed for two-dimensional (2-D) nanostructures. Theoretically, the magnitude of control of thermal transport should be even stronger in three-dimensional (3-D) phononic crystal structures. For that reason, the question arises how to fabricate the desire…

self-assemblyNIS tunnel junctionsphononic crystalssingle-step vertical depositionfononit
researchProduct

Thermoelectric radiation detector based on a superconductor-ferromagnet junction : Calorimetric regime

2018

We study the use of a thermoelectric junction as a thermal radiation detector in the calorimetric regime, where single radiation bursts can be separated in time domain. We focus especially on the case of a large thermoelectric figure of merit ZT affecting significantly, for example, the relevant thermal time scales. This work is motivated by the use of hybrid superconductor/ferromagnet systems in creating an unprecedentedly high low-temperature ZT even exceeding unity. Besides constructing a very general noise model which takes into account cross correlations between charge and heat noise, we show how the detector signal can be efficiently multiplexed by the use of resonant LC circuits givi…

superconducting filmsthermodynamic measurements and instrumentationradiation detectorssignaalinkäsittelyilmaisimetinductorsferromagnetic materialsquasiparticlelämpösäteilytelecommunications engineeringfononitsuprajohteet
researchProduct

Time-dependent quantum transport in nanosystems : a nonequilibrium Green's function approach

2016

A time-dependent extension to the Landauer–Büttiker approach to study transient quantum transport in arbitrary junctions composed of leads and conducting devices is developed. The nonequilibrium Green’s function approach is employed for describing the charge and heat transport dynamics. The importance of the developed method is that it provides a closed formula for the time-dependent density matrix in both electronic and phononic systems. In the electronic case the nonequilibrium conditions are due to a switch-on of a bias voltage in the leads or a perturbation in the junction whereas in the phononic case the central region of interest is coupled to reservoirs of di erent temperatures. In b…

suprajohtavuusnanoelektroniikkasuperconductivitygrapheneGreen's functionsähkönjohtavuusnanorakenteetelectronic transportnanoscale electronicslämmön johtuminengrafeenikvanttifysiikkaheat transportquantum transportfononit
researchProduct

Electron-phonon interaction in flat-band superconductivity

2017

Parhaiten tunnettu suprajohtavuuden syntymekanismi perustuu fononien välittämään vetovoimaan elektronien välillä. Tässä tutkielmassa tutkin fononien välittämää suprajohtavuutta systeemeissä, jossa elektronivyöt ovat tasomaisia. Tasovyöllä elektronien dispersio on erittäin heikko, jolloin tilatiheys on tavanomaista suurempi. Tämän takia suprajohtavuus tasovyöllä on tavanomaista voimakkaampi silloin kun elektronien välinen vetovoima on heikko. Eliashbergin teoria on elektroni–fononi-suprajohtavuuden teoria, joka ottaa luonnollisella tavalla fononien äärellisen nopeuden huomioon elektronien välisessä vuorovaikutuksessa. Pohjustuksena tasovyösuprajohtavuuteen perehdyn Eliashbergin teoriaan ensi…

suprajohtavuussuperconductivityflat bandelektroni-fononi-vuorovaikutusromboedrinen grafiittielektronitpintatilattasovyörombohedral graphiteEliashbergin teoriaelectron-phonon interactionsurface statesEliashberg theoryfononit
researchProduct

Acoustic wave tunneling across a vacuum gap between two piezoelectric crystals with arbitrary symmetry and orientation

2022

It is not widely appreciated that an acoustic wave can “jump” or “tunnel” across a vacuum gap between two piezoelectric solids, nor has the general case been formulated or studied in detail. Here, we remedy that situation, by presenting a general formalism and approach to study such an acoustic tunneling effect between two arbitrarily oriented anisotropic piezoelectric semi-infinite crystals. The approach allows one to solve for the reflection and transmission coefficients of all the partial-wave modes, and is amenable to practical numerical or even analytical implementation, as we demonstrate by a few chosen examples. The formalism can be used in the future for quantitative studies of the …

värähtelytCondensed Matter - Mesoscale and Nanoscale PhysicsaaltoliikeMesoscale and Nanoscale Physics (cond-mat.mes-hall)kiinteän olomuodon fysiikkaFOS: Physical scienceskiteetfononit
researchProduct