Search results for "functional"

showing 10 items of 4822 documents

Organic food businesses in local alternative agri-food networks in Pirkanmaa region in Finland

2008

environmental entrepreneurmultifunctionalityympäristömaatalouslocal quality foodorganicluonnonmukaisuusPirkanmaaagri-food networkfarmyrityksetalternative
researchProduct

High‐resolution 3D forest structure explains ecomorphological trait variation in assemblages of saproxylic beetles

2022

1. Climate, topography and the 3D structure of forests are major drivers affecting local species communities. However, little is known about how the specific functional traits of saproxylic (wood-living) beetles, involved in the recycling of wood, might be affected by those environmental characteristics. 2. Here, we combine ecological and morphological traits available for saproxylic beetles and airborne laser scanning (ALS) data in Bayesian trait-based joint species distribution models to study how traits drive the distributions of more than 230 species in temperate forests of Europe. 3. We found that elevation (as a proxy for temperature and precipitation) and the proportion of conifers p…

environmental gradientLiDARairborne laser scanning; Bayesian modelling; Coleoptera; environmental gradient; functional traits; HMSC; LiDAR; phylogenyDIVERSITYMELANISMairborne laser scanningECOLOGYphylogenyfunctional traits3D-mallinnusPREDICTORSEcology Evolution Behavior and SystematicskovakuoriaisetlajistokartoitusfylogeniaEcologybayesilainen menetelmäeliöyhteisötilmastonmuutoksetHMSCmetsätEVOLUTIONColeopteraMORPHOLOGICAL TRAITSFUNCTIONAL TRAITS1181 Ecology evolutionary biologyBIODIVERSITYABUNDANCEBayesian modellingympäristönmuutoksetlaserkeilausRESPONSESFunctional Ecology
researchProduct

The Waves of Time Revisited : Glimpses of life

2022

This study could perhaps be characterized as the art of walking in time, verbally, pictorially and abstractly, i.e. using words, images and thoughts. Of course, the ideal of essayism also includes a scientific dimension. Equally the aim is to make multi-level use of the idea of dialogue. At the same time, the writer is also carrying on a monologue (with himself), an aspect that is called dialogic monologue. After all, the respondent, too, is himself the questioner. Architecture and the essay are reminiscent of each other. The created building and the created word are close relatives. An essayistic study signifies a hermetic state of language. A text’s inner verbal room is constructed from a…

esseetAino and Alvar Aaltokotifunctionalismfunktionalismiarkkitehtuuriasuinrakennuksettilaarkkitehditpaikkaessayismvalokuvatspirit of the place
researchProduct

What Contributes to the Measured Chiral Optical Response of the Glutathione-Protected Au25 Nanocluster?

2023

The water-soluble glutathione-protected [Au25(GSH)18]−1 nanocluster was investigated by integrating several methodologies such as molecular dynamics simulations, essential dynamics analysis, and state-of-the-art time-dependent density functional theory calculations. Fundamental aspects such as conformational, weak interactions and solvent effects, especially hydrogen-bonds, were included and found to play a fundamental role in assessing the optical response of this system. Our analysis demonstrated not only that the electronic circular dichroism is extremely sensitive to the solvent presence but also that the solvent itself plays an active role in the optical activity of such system, formin…

essential dynamicsklusterittiheysfunktionaaliteoriachiralitynanoklusteritnanoclusternanohiukkasetmolekyylidynamiikkagoldthiolsmolecular dynamicsdensity functional theorykulta
researchProduct

Poincaré Type Inequalities for Vector Functions with Zero Mean Normal Traces on the Boundary and Applications to Interpolation Methods

2019

We consider inequalities of the Poincaré–Steklov type for subspaces of H1 -functions defined in a bounded domain Ω∈Rd with Lipschitz boundary ∂Ω . For scalar valued functions, the subspaces are defined by zero mean condition on ∂Ω or on a part of ∂Ω having positive d−1 measure. For vector valued functions, zero mean conditions are applied to normal components on plane faces of ∂Ω (or to averaged normal components on curvilinear faces). We find explicit and simply computable bounds of constants in the respective Poincaré type inequalities for domains typically used in finite element methods (triangles, quadrilaterals, tetrahedrons, prisms, pyramids, and domains composed of them). The second …

estimates of constants in functional inequalitiesvektorit (matematiikka)interpolointiPoincaré type inequalitiesinterpolation of functionsfunktiot
researchProduct

Revista electrónica interuniversitaria de formación del profesorado

2016

La realidad socioeducativa actual demanda de los profesionales de la educación una intervención comprometida y coherente para el desarrollo de competencias y habilidades emocionales. Es necesario complementar lo académico y cuantificable con aquello que sobrepasa las barreras del centro e influye en el rendimiento y desarrollo personal y social del alumnado. Las relaciones que se dan entre los componentes de la triada emoción, pensamiento y acción regulan cada momento de nuestros días, pudiéndose ver estas alteradas negativamente por estímulos externos que en ocasiones, no somos capaces de gestionar adecuadamente. Esta incorrecta gestión emocional tiene su base en un creciente analfabetismo…

estrategia de aprendizajerelaciones interpersonalesRealisationControl (management)Primary educationenseñanza primariaContext (language use)emociónlcsh:Education (General)Educationeducación de la afectividadResource (project management)Action (philosophy)dramatizaciónAprenentatgeIntervention (counseling)PedagogyPsychologylcsh:L7-991Functional illiteracyRevista Electronica Interuniversitaria de Formación del Profesorado
researchProduct

The Greek Verb. Morphology, Syntax, Semantics. Proceedings of the 8th International Meeting on Greek Linguistics. Agrigento, October 1-3, 2009

2014

Despite the difficulties of reconstructing the grammar of a dead language, studying Ancient Greek offers new insights for linguistic theory. The morphological complexity of the Greek verb with its highly intricate inflectional system provide a valuable basis for an in-depth-analysis of the mechanisms which regulate the functioning of a language. Studies on the Ancient Greek verb have also contributed significantly to the reconstruction of the Indo-European language since the early history of Linguistics in the nineteenth century. The conservative features preserved in the oldest stages of Greek allow us to rely on a solid basis to which every linguist must refer in investigating a model of …

etimologycognitive linguisticDistributed MorphologymorphologyAncient Greek verbal systemsemanticfunctional linguisticgrammatical categorietypological linguisticIndo-EuropeansyntaxpragmaticSettore L-LIN/01 - Glottologia E Linguistica
researchProduct

Feasibility in routine clinical setting of combined resting-state fMRI and DTI-tractography for surgical planning of brain tumors

2020

Purpose Methods and materials Results Conclusion Personal information and conflict of interest References

fMRI DTI-tractography Brain Neuroimaging resting-state fMRINeuroradiology brainRetrospectivePerformed at one institutionDiagnostic or prognostic studyMRDiagnostic procedureTechnical aspectsMRIMR-Diffusion/PerfusionMR-Functional imagingCancer
researchProduct

Conventional Theory’s Relevance: Evidence from Japan

2019

Abstract The formidable surge in the volume of international trade after 1960 stimulated surveys designed to ascertain to what degree the commercial flows among nations reflected the structure of their economies, in other words, how tight was the correlation between international exchanges and the specific attributes of participating nations. In fact, scholars were keen to test the relevance of the conventional Heckscher-Ohlin theory, that is, to what extent did nations’ exports reflect their endowment with factors of production, more specifically, whether their exports used their abundant factors intensively. I try to show that, although most of the tests reached their purpose in that they…

factor intensityLabor mobilityEntrepreneurship050208 financeHF5001-6182Social Psychologyreal wageEndowment05 social sciencesEconomics Econometrics and Finance (miscellaneous)Factors of productionInternational economicsWorld economy0502 economics and businessSpecialization (functional)EconomicsBusiness Management and Accounting (miscellaneous)Relevance (law)Business050211 marketinglabor mobilityfactor specificityUncannyfactor proportionStudies in Business and Economics
researchProduct

Gender-Typed Sport Practice, Physical Self-Perceptions, and Performance-Related Emotions in Adolescent Girls

2020

Youth sport experience provides opportunities for physical, personal, and social development in youngsters. Sport is a social system in which socially constructed gender differences and stereotypes are incorporated, and specific sport activities are often perceived as gender characterized. The objective of this study was to examine the relationship between some salient physical and emotional self-perceptions and the type of sport practiced. A sample of 261 female athletes, aged 14–21 years (Mage = 15.59, SD = 2.00), practicing different sports, categorized as feminine (e.g., artistic and rhythmic gymnastics), masculine (e.g., soccer and rugby), or neutral (e.g., track and field and tennis),…

feminine sportsminäkuvabiopsykologiamedia_common.quotation_subjectitsetuntemusGeography Planning and Developmentlcsh:TJ807-830lcsh:Renewable energy sources050109 social psychologyDysfunctional familyManagement Monitoring Policy and LawHuman physical appearanceliikuntasosiaaliset normitmasculine sportsDevelopmental psychologysukupuolisocial physique anxiety03 medical and health sciences0302 clinical medicinePerception0501 psychology and cognitive sciencesphysical self-perception; body dissatisfaction; social physique anxiety; psychobiosocial states; aesthetic sports; feminine sports; masculine sportsTrack and field athleticslcsh:Environmental sciencesmedia_commonlcsh:GE1-350sukupuolivaikutuksetbiologyRenewable Energy Sustainability and the EnvironmentAthleteslcsh:Environmental effects of industries and plants05 social sciencesSocial change030229 sport sciencesbiology.organism_classificationlcsh:TD194-195Feelingphysical self-perceptionpsychobiosocial statesWorryPsychologyhuman activitiesbody dissatisfactionaesthetic sportsSustainability
researchProduct