Search results for "grafeeni"

showing 8 items of 48 documents

Optical properties of conductive carbon-based nanomaterials

2016

The interaction of light with carbon nanomaterials is the main focus of this thesis. I explore several nanostructured systems involving different allotropes of carbon, and characterize them both electrically, if applicable, and optically. Special attention is paid to search for plasmon-like excitations on the systems, or utilizing surface plasmons on characterization. The first objective is to achieve control of carbon nanotube (CNT) conductivity with surface plasmon polaritons (SPPs), which resulted in the first CNT field-effect transistor (FET) that can be gated definitively with SPPs. The second objective is the investigation of optical properties of various thin carbon-based molecular n…

spectroscopycarbon nanotubesoptoelectronicshiiligraphenespektroskopiananomateriaalitoptoelektroniikkaoptiset ominaisuudetplasmonicssähkönjohtavuusplasmonitkanavatransistoritnanorakenteettransistoritgrafeeninanoputketohutkalvotpolymeeritconductive polymers
researchProduct

Tuning protein adsorption on graphene surfaces via laser-induced oxidation

2021

An approach for controlled protein immobilization on laser-induced two-photon (2P) oxidation patterned graphene oxide (GO) surfaces is described. Selected proteins, horseradish peroxidase (HRP) and biotinylated bovine serum albumin (b-BSA) were successfully immobilized on oxidized graphene surfaces, via non-covalent interactions, by immersion of graphene-coated microchips in the protein solution. The effects of laser pulse energy, irradiation time, protein concentration and duration of incubation on the topography of immobilized proteins and consequent defects upon the lattice of graphene were systemically studied by atomic force microscopy (AFM) and Raman spectroscopy. AFM and fluorescence…

spektroskopiagrafeenihapettuminenproteiinitatomivoimamikroskopialasertekniikkamikrosirutfluoresenssimikroskopia
researchProduct

Mean-field theory for superconductivity in twisted bilayer graphene

2018

Recent experiments show how a bilayer graphene twisted around a certain magic angle becomes superconducting as it is doped into a region with approximate flat bands. We investigate the mean-field s-wave superconducting state in such a system and show how the state evolves as the twist angle is tuned, and as a function of the doping level. We argue that part of the experimental findings could well be understood to result from an attractive electron-electron interaction mediated by electron-phonon coupling, but the flat-band nature of the excitation spectrum also makes the superconductivity quite unusual. For example, as the flat-band states are highly localized around certain spots in the st…

superconducting phase transitionsuperconducting gapsuprajohtavuusCondensed Matter::Superconductivitygrafeenisuperconducting order parameter
researchProduct

Flat-band superconductivity in strained Dirac materials

2016

We consider superconducting properties of a two-dimensional Dirac material such as graphene under strain that produces a flat band spectrum in the normal state. We show that in the superconducting state, such a model results in a highly increased critical temperature compared to the case without the strain, inhomogenous order parameter with two-peak shaped local density of states and yet a large and almost uniform and isotropic supercurrent. This model could be realized in strained graphene or ultracold atom systems and could be responsible for unusually strong superconductivity observed in some graphite interfaces and certain IV-VI semiconductor heterostructures.

superconducting propertiesMaterials sciencesuprajohtavuusDirac (software)FOS: Physical sciences02 engineering and technology01 natural scienceslaw.inventionsuprajohteetSuperconductivity (cond-mat.supr-con)Condensed Matter::Materials SciencelawUltracold atompuolijohteetCondensed Matter::Superconductivity0103 physical sciencesgrafeeniGraphite010306 general physicsSuperconductivityLocal density of statesCondensed matter physicsta114Dirac materialsGrapheneCondensed Matter - SuperconductivityIsotropySupercurrent021001 nanoscience & nanotechnology0210 nano-technologyPhysical Review B
researchProduct

Superfluid weight and Berezinskii-Kosterlitz-Thouless transition temperature of twisted bilayer graphene

2019

We study superconductivity of twisted bilayer graphene with local and non-local attractive interactions. We obtain the superfluid weight and Berezinskii-Kosterlitz-Thouless (BKT) transition temperature for microscopic tight-binding and low-energy continuum models. We predict qualitative differences between local and non-local interaction schemes which could be distinguished experimentally. In the flat band limit where the pair potential exceeds the band width we show that the superfluid weight and BKT temperature are determined by multiband processes and quantum geometry of the band.

suprajohtavuusINSULATORsuperfluid densitymultiband superconductivityFOS: Physical sciences02 engineering and technologyBKT transition01 natural sciences114 Physical sciencessuperconducting phase transitionSuperconductivity (cond-mat.supr-con)SuperfluidityMAGIC-ANGLEsuperconducting fluctuationsnanorakenteetCondensed Matter::SuperconductivityMesoscale and Nanoscale Physics (cond-mat.mes-hall)0103 physical sciencesgrafeeni010306 general physicsQuantumPhysicsSuperconductivityCondensed Matter::Quantum GasesCondensed matter physicsCondensed Matter - Mesoscale and Nanoscale PhysicsCondensed Matter::OtherSUPERCONDUCTIVITYCondensed Matter - SuperconductivityORDER021001 nanoscience & nanotechnologySTATEsuperconducting RFKosterlitz–Thouless transitionPairingDENSITYBerry connection and curvature0210 nano-technologyBilayer graphene
researchProduct

Time-dependent quantum transport in nanosystems : a nonequilibrium Green's function approach

2016

A time-dependent extension to the Landauer–Büttiker approach to study transient quantum transport in arbitrary junctions composed of leads and conducting devices is developed. The nonequilibrium Green’s function approach is employed for describing the charge and heat transport dynamics. The importance of the developed method is that it provides a closed formula for the time-dependent density matrix in both electronic and phononic systems. In the electronic case the nonequilibrium conditions are due to a switch-on of a bias voltage in the leads or a perturbation in the junction whereas in the phononic case the central region of interest is coupled to reservoirs of di erent temperatures. In b…

suprajohtavuusnanoelektroniikkasuperconductivitygrapheneGreen's functionsähkönjohtavuusnanorakenteetelectronic transportnanoscale electronicslämmön johtuminengrafeenikvanttifysiikkaheat transportquantum transportfononit
researchProduct

Modeling the mechanical behavior of carbon nanostructures

2016

Low-dimensional nanostructures are expected to have vast number of applications in the future. Particularly large amount of research has been invested in the atomthick carbon membrane called graphene, which has become popular due to its unique electronic and mechanical properties. This thesis presents studies of the mechanical and electromechanical properties of several different types of graphene nanostructures. In addition, short detours are performed in order to study the elasticity of gold nanostructures and topology effects in graphene nanoribbons. The research is performed by using several different simulation methods. In simulations the system parameters and environment can be chosen…

topologymekaniikkahiiligraphenesimulationfysikaaliset ominaisuudetkimmoisuusnanorakenteetgrafeenielasticitysimulointitopologiamechanicsgraphene nanoribbonselectromechanics
researchProduct

Typpiseostettu grafeeni

2017

Tässä Pro Gradu -tutkielmassa perehdytään typpiseostetun grafeenin rakenteeseen, ominaisuuksiin, karakterisointiin, valmistukseen ja sovelluksiin. Valtaosa typpiseostetun grafeenin ominaisuuksista pohjautuu puhtaaseen grafeeniin, joten myös sitä käsitellään samalla. Typpi voi sitoutua grafeenihilaan eri tavoilla, joten mahdolliset konfiguraatiot ja niiden vaikutus rakenteeseen ja grafeenin ominaisuuksiin käydään läpi. Spektroskopia ja karakterisointi -kappaleessa keskitytään eniten puhtaan ja typpiseostetun grafeenin ramanspektroskopiaan ja röntgensädefluoresenssispektroskopiaan (XPS). Valmistuskeinot-kappaleessa kerrotaan lyhyesti grafeenin yleisimmistä synteesimenetelmistä ja käydään läpi…

typpiseostaminentyppiseostettu grafeenigrafeeni
researchProduct