Search results for "graphene"

showing 6 items of 496 documents

Flat-band superconductivity in strained Dirac materials

2016

We consider superconducting properties of a two-dimensional Dirac material such as graphene under strain that produces a flat band spectrum in the normal state. We show that in the superconducting state, such a model results in a highly increased critical temperature compared to the case without the strain, inhomogenous order parameter with two-peak shaped local density of states and yet a large and almost uniform and isotropic supercurrent. This model could be realized in strained graphene or ultracold atom systems and could be responsible for unusually strong superconductivity observed in some graphite interfaces and certain IV-VI semiconductor heterostructures.

superconducting propertiesMaterials sciencesuprajohtavuusDirac (software)FOS: Physical sciences02 engineering and technology01 natural scienceslaw.inventionsuprajohteetSuperconductivity (cond-mat.supr-con)Condensed Matter::Materials SciencelawUltracold atompuolijohteetCondensed Matter::Superconductivity0103 physical sciencesgrafeeniGraphite010306 general physicsSuperconductivityLocal density of statesCondensed matter physicsta114Dirac materialsGrapheneCondensed Matter - SuperconductivityIsotropySupercurrent021001 nanoscience & nanotechnology0210 nano-technologyPhysical Review B
researchProduct

Superfluid weight and Berezinskii-Kosterlitz-Thouless transition temperature of twisted bilayer graphene

2019

We study superconductivity of twisted bilayer graphene with local and non-local attractive interactions. We obtain the superfluid weight and Berezinskii-Kosterlitz-Thouless (BKT) transition temperature for microscopic tight-binding and low-energy continuum models. We predict qualitative differences between local and non-local interaction schemes which could be distinguished experimentally. In the flat band limit where the pair potential exceeds the band width we show that the superfluid weight and BKT temperature are determined by multiband processes and quantum geometry of the band.

suprajohtavuusINSULATORsuperfluid densitymultiband superconductivityFOS: Physical sciences02 engineering and technologyBKT transition01 natural sciences114 Physical sciencessuperconducting phase transitionSuperconductivity (cond-mat.supr-con)SuperfluidityMAGIC-ANGLEsuperconducting fluctuationsnanorakenteetCondensed Matter::SuperconductivityMesoscale and Nanoscale Physics (cond-mat.mes-hall)0103 physical sciencesgrafeeni010306 general physicsQuantumPhysicsSuperconductivityCondensed Matter::Quantum GasesCondensed matter physicsCondensed Matter - Mesoscale and Nanoscale PhysicsCondensed Matter::OtherSUPERCONDUCTIVITYCondensed Matter - SuperconductivityORDER021001 nanoscience & nanotechnologySTATEsuperconducting RFKosterlitz–Thouless transitionPairingDENSITYBerry connection and curvature0210 nano-technologyBilayer graphene
researchProduct

Time-dependent quantum transport in nanosystems : a nonequilibrium Green's function approach

2016

A time-dependent extension to the Landauer–Büttiker approach to study transient quantum transport in arbitrary junctions composed of leads and conducting devices is developed. The nonequilibrium Green’s function approach is employed for describing the charge and heat transport dynamics. The importance of the developed method is that it provides a closed formula for the time-dependent density matrix in both electronic and phononic systems. In the electronic case the nonequilibrium conditions are due to a switch-on of a bias voltage in the leads or a perturbation in the junction whereas in the phononic case the central region of interest is coupled to reservoirs of di erent temperatures. In b…

suprajohtavuusnanoelektroniikkasuperconductivitygrapheneGreen's functionsähkönjohtavuusnanorakenteetelectronic transportnanoscale electronicslämmön johtuminengrafeenikvanttifysiikkaheat transportquantum transportfononit
researchProduct

Sensors for the monitoring of analytes in the sweat

In the last decade, can be found an exceptional growth in research activity relating to the development of wearable devices, capable of continuously monitoring the health conditions of the wearer by analyzing body fluids such as blood, urine, saliva, tears and sweat. Among the body fluids available, sweat is a biofluid of particular interest, as it allows a non-invasive, continuous and comfortable collection. Human sweat contains useful information on the health of an individual and therefore is an excellent biofluid for the detection of specific analytes. The most abundant ions in the sweat are Na+ and Cl- (10 - 100 mM), and their monitoring is useful in patients with cystic fibrosis. Othe…

sweatelectrochemical sensorpH sensorwearable sensorreduced graphene oxidepolyaniline
researchProduct

Modeling the mechanical behavior of carbon nanostructures

2016

Low-dimensional nanostructures are expected to have vast number of applications in the future. Particularly large amount of research has been invested in the atomthick carbon membrane called graphene, which has become popular due to its unique electronic and mechanical properties. This thesis presents studies of the mechanical and electromechanical properties of several different types of graphene nanostructures. In addition, short detours are performed in order to study the elasticity of gold nanostructures and topology effects in graphene nanoribbons. The research is performed by using several different simulation methods. In simulations the system parameters and environment can be chosen…

topologymekaniikkahiiligraphenesimulationfysikaaliset ominaisuudetkimmoisuusnanorakenteetgrafeenielasticitysimulointitopologiamechanicsgraphene nanoribbonselectromechanics
researchProduct

Electrochemical sensor for phosphate ions based on laser scriber reduced graphene oxide

2022

This preliminary work shows a new and innovative way to produce laser scribed reduced graphene oxide (LSGO) electrodes using different porous substrates (ranging from paper to plastic and fabric). The obtained electrodes were also tested as electrochemical sensors towards the detection of phosphate ions in water. To obtain the electrodes, a water suspension of GO was filtered on top of substrate (such as Whatman® filter paper) and a complete sensor was obtained from its reduction using a CO2 laser. The electrode is composed of working and counter electrodes made of LSGO and a reference electrode of a Ag/AgCl obtained by using a commercial AgCl conductive paste. Phosphate ions were detected …

voltammetrySettore ING-IND/23 - Chimica Fisica ApplicataElectrochemical sensorPhosphate ionSettore ING-IND/17 - Impianti Industriali MeccaniciVoltammetryPhosphate ionspaper based elecxtrodePaper based electrodesReduced graphene oxideEectrochemical sensorreduced graphene oxide2022 IEEE International Conference on Flexible and Printable Sensors and Systems (FLEPS)
researchProduct