Search results for "hiukkaskiihdyttimet"

showing 8 items of 58 documents

Quasi-periodical kinetic instabilities in minimum-B confined plasma

2022

We present the results of an experimental investigation of quasi-periodical kinetic instabilities exhibited by magnetically confined electron cyclotron resonance heated plasmas. The instabilities were detected by measuring plasma microwave emission, electron losses, and wall bremsstrahlung. The instabilities were found to be grouped into fast sequences of periodic plasma losses, separated by ∼100 µs between the bursts, followed by 1–10 ms quiescent periods before the next event. Increasing the plasma energy content by adjusting the plasma heating parameters, in particular the magnetic field strength, makes the instabilities more chaotic in the time domain. Statistical analysis reveals that …

plasma confinemention sourcessyklotronitPhysicsQC1-999ECR-ionilähteetGeneral Physics and Astronomyplasma heatingplasma instabilitiescyclotron resonancehiukkaskiihdyttimetplasmafysiikkaAIP Advances
researchProduct

Characteristic Kα emission of electron cyclotron resonance ion source plasmas

2018

This thesis presents the results of an investigation of the volumetric Kα emission rate/inner shell ionization rate from an Electron Cyclotron Resonance Ion Source (ECRIS) plasma tuned predominantly for high charge state ion production. The experimental work include four complimentary studies covering the influence of a parametric sweep of the four source tune parameters i.e microwave power, neutral gas flow, biased disc voltage and magnetic field on the volumetric Kα emission rate, an investigation into the gas mixing effect, an investigation into the effectiveness of double-frequency heating mode and finally an investigation into microwave induced electron losses (relative and direct) from th…

plasma diagnosticsPhysics::Plasma Physicsplasma (kaasu)syklotronitelectron lossesvolumetric Kα emissionhiukkaskiihdyttimetplasmafysiikkaECRISemissio (fysiikka)
researchProduct

Effects of magnetic configuration on hot electrons in a minimum-B ECR plasma

2020

To investigate the hot electron population and the appearance of kinetic instabilities in highly charged electron cyclotron resonance ion source (ECRIS), the axially emitted bremsstrahlung spectra and microwave bursts emitted from ECRIS plasma were synchronously measured on SECRAL-II (Superconducting ECR ion source with Advanced design in Lanzhou No. II) ion source with various magnetic field configurations. The experimental results show that when the ratio of the minimum field to the resonance field (i.e. Bmin/Becr) is less than ~0.8, the bremsstrahlung spectral temperature Ts increases linearly with the Bmin/Becr–ratio when the injection, extraction and radial mirror fields are kept const…

plasma physicshiukkaskiihdyttimetplasmafysiikka
researchProduct

Mechanisms of Electron-Induced Single Event Upsets in Medical and Experimental Linacs

2018

In this paper, we perform an in-depth analysis of the single-event effects observed during testing at medical electron linacs and an experimental high-energy electron linac. For electron irradiations, the medical linacs are most commonly used due to their availability and flexibility. Whereas previous efforts were made to characterize the cross sections at higher energies, where the nuclear interaction cross section is higher, the focus of this paper is on the complete overview of relevant electron energies. Irradiations at an electron linac were made with two different devices, with a large difference in feature size. The irradiations at an experimental linac were performed with varying en…

radiation physicssäteilyfysiikkaelectronshiukkaskiihdyttimetelektronitparticle accelerators
researchProduct

Mechanisms of Electron-Induced Single Event Latchup

2019

In this paper, possible mechanisms by which electrons can induce single-event latchups in electronics are discussed. The energy deposition and the nuclear fragments created by electrons in silicon are analyzed in this context. The cross section enhancement effect in the presence of high-Z materials is discussed. First experimental results of electron-induced latchups are shown in static random access memory devices with low linear energy transfer thresholds. The radiation hardness assurance implications and future work are discussed. peerReviewed

radiation physicssäteilyfysiikkaelectronshiukkaskiihdyttimetelektronitparticle accelerators
researchProduct

Abstract book and programme : 12th European Conference on Accelerators in Applied Research and Technology, July 3-8, 2016, Jyväskylä, Finland : ecaar…

2016

soveltava tutkimusfysiikkahiukkaskiihdyttimet
researchProduct

Different dynamic regimes of stimulated electron-cyclotron emission from mirror-confined non-equilibrium plasma

2019

syklotronithiukkaskiihdyttimetplasmafysiikka
researchProduct

Portaalidosimetrian käyttö sädehoitokiihdyttimen laadunvarmistuksessa

2009

sädehoitolaadunvarmistusilmaisimetdosimetrithiukkaskiihdyttimetportaalidosimetria
researchProduct