Search results for "hyönteiset"

showing 10 items of 56 documents

Genetics of condition and sexual selection

2007

FM Tarmo Ketolan ekologian ja ympäristönhoidon väitöskirjan ”Genetics of Condition and Sexual Selection” (Kunnon ja seksuaalivalinnan genetiikka) tarkastustilaisuus Jyväskylän yliopistossa. Vastaväittäjänä professori Juha Merilä (Helsingin yliopisto) ja kustoksena dosentti Janne Kotiaho.Linkki väitöksen pdf-versioon tiedotteen lopussa.FM Tarmo Ketola havaitsi väitöstutkimuksessaan, että geneettisesti huonolaatuiset sirkkayksilöt pystyvät käyttämään vähemmän energiaa aktiviteetteihin kuin hyvälaatuiset. Koska sisäsiitos lisäsi perusenergiankulutusta eli ruumiintoimintojen ylläpitoon kulutettua energiaa, se heikensi yksilöiden kuntoa.– Aiemmin on oletettu, että huonolaatuisilla yksilöillä on …

quantitative geneticsperinnöllisyystiedesukupuolivalintaGryllodes sigillatusenergy metabolismhyönteisetinbreedingsexual selectionmutationsseksuaalisuusconditionkuntoperinnöllisyys
researchProduct

Hyperspectral Imaging of Macroinvertebrates : a Pilot Study for Detecting Metal Contamination in Aquatic Ecosystems

2018

The applicability of spectral analysis in detection of freshwater metal contamination was assessed by developing and testing a novel hyperspectral imaging (HSI) application for aquatic insect larvae (Trichoptera: Hydropsychidae). Larvae were first exposed to four different cadmium (Cd) concentrations: 0, 1, 10, and 100 μg L−1 for 96 h. Individual larvae were then preserved in ethanol, inspected with microscopy for the number of anomalies in larval gills, and imaged by hyperspectral camera operating with wavebands between 500 and 850 nm. Three additional larvae from each exposure were analyzed for tissue Cd concentration. Although the larval tissue Cd concentrations correlated positively wit…

raskasmetallittoukatanimal structuresmetal pollutionhyperspectral imagingvesien saastuminenfungispektrikuvausFabry-Perot interferometerhyönteisetaquatic insect larvaecadmium toxicitykadmium
researchProduct

Subtropical streams harbour higher genus richness and lower abundance of insects compared to boreal streams, but scale matters

2018

Aim: Biological diversity typically varies between climatically different regions, and regions closer to the equator often support higher numbers of taxa than those closer to the poles. However, these trends have been assessed for a few organism groups, and the existing studies have rarely been based on extensive identical surveys in different climatic regions. Location: We conducted standardized surveys of wadeable streams in a boreal (western Finland) and a subtropical (south-eastern Brazil) region, sampling insects identically from 100 streams in each region and measuring the same environmental variables in both regions. Taxon: Aquatic insects. Methods: Comparisons were made at the scale…

regional diversity0106 biological sciencespurotBiodiversitySTREAMSSubtropics010603 evolutionary biology01 natural sciencesMACROINVERTEBRATE COMMUNITIESlow-high latitude comparisonnutrientsAbundance (ecology)stream insectsrank abundance1172 Environmental sciencesEcology Evolution Behavior and SystematicsGLOBAL PATTERNSEcologyEcologySPECIES RICHNESSBEETLES COLEOPTERA010604 marine biology & hydrobiologysubtrooppinen vyöhykealpha diversity15. Life on landBETA DIVERSITYlow–high latitude comparisonEVOLUTIONbiodiversiteettiLATITUDINAL DIVERSITY GRADIENTENVIRONMENTAL-CONDITIONSboreaalinen vyöhykeGeographyBoreal13. Climate action1181 Ecology evolutionary biologyhyönteisetta1181BIODIVERSITYAlpha diversityRank abundance curveSpecies richnessORGANISMSJournal of Biogeography
researchProduct

Importance of diet and prophylactic treatment on survival and immunity of polyphagous Arctia plantaginis (Arctiidae) larvae

2018

Diet is one of the major factors directly and indirectly influencing insect’s life history traits and risk of getting infected. Additionally the insect’s fitness is severely affected by the broad diversity of parasites they are exposed to. As a consequence insects have developed well-evolved defences. Behavioural responses include self-medication, the ability of insects to change dietary intake in response to an infection. When studying this ability it is of major importance to consider the insects natural diet range. In this thesis I investigated the effect of different host plants on fitness and immunocompetence of polyphagous Arctia plantaginis larvae and whether the larvae can therapeut…

siilikkäätratamotisäntäkasvitfungiperhosetimmunityeläinten käyttäytymineninfektiotresistenssiravintotoukatplantaginiskasvinsyöjäthyönteisetmedicationimmuniteettidiet-mixingprophylaxisvoikukatArctia plantaginisestolääkitys
researchProduct

Production, purification and evaluation of insect cell-expressed proteins with diagnostic potential

2008

Patrik Michelin väitöskirjan aiheena on useiden erityyppisten rekombinanttiproteiinien tuotto, puhdistus ja karakterisointi. Rekombinanttiproteiinit ovat keskeisessä asemassa kehitettäessä uusia diagnostisia menetelmiä. Näiden proteiinien tuotossa organismiin lisätään muokattua vierasta geneettistä materiaalia, jotta organismi tuottaisi tavoiteltua proteiinia. Tuottoprosessit sisältävät puhdistusvaiheita, jotta haluttu proteiini voidaan eristää elävästä, monimutkaisesta lähtömateriaalista. Tuottoprosessissa on ainakin seuraavat vaiheet: tuotto-organismin kasvatus, rekombinanttiproteiinien tuotto isäntäsolussa ja lopputuotteen jälkikäsittely. Tämän jälkeen rekombinanttiproteiineja voidaan kä…

solutbakuloviruksetrekombinanttiproteiinihyönteisetgeenitekniikkaproteiinit
researchProduct

Purification and characterization of the mda-7 tumor suppressor protein expressed in insect cells

2008

solutohjelmoitunut solukuolemaIL-24mda-7apoptosishyönteisetcancer therapysyöpätauditcancer cell
researchProduct

Environmental factors modulating cold tolerance, gene expression and metabolism in Drosophila montana

2011

sopeutuminenseasonalitymahlakärpäsetympäristötekijätcold toleranceD. virilislisääntyminenmetabolomicsphenotypic plasticitytalvehtiminenakklimatisaatiokylmänkestävyysDrosophila montanagene expressionhyönteisetkylmyyslämpötilageeniekspressioaineenvaihduntavalovuorokausirytmi
researchProduct

Eco-physiological aspects of adaptation to seasonal environments : the latitudinal range expansion of the Colorado potato beetle across Europe

2013

sopeutuminenvuodenaikaisvaihtelutulokaslajitkoloradonkuoriainenrapid adaptationekofysiologiaphenologyphenotypic plasticityfotoperiodismituhohyönteisetpäivänpituusfenologiakasvukausilocal adaptationleviäminen
researchProduct

Adaptation to stressful environments : invasion success of the Colorado potato beetle (Leptinotarsa decemlineata)

2018

Biological invasions, specifically human-induced dispersals, are one of the major threats to our biodiversity and are predicted to increase. Invasive pests provide an opportunity to study whether adaptation to human-induced environments could promote invasions to other human-induced environments. One major anthropogenic selection pressure is created by pesticides, and pests can be exposed to various pesticides in their native, as well as introduced, ranges. I investigated whether exposure to anthropogenic selection (i.e. insecticides and herbicides) and exposure to multiple anthropogenic stressors selects for higher stress tolerance. I also tested whether parental prolonged diapause or inse…

species invasionssopeutuminenstress tolerancekoloradonkuoriainentuhoeläimettorjunta-aineetadaptationherbisiditinsektisiditpest speciesinsecticide stresstuhohyönteisetherbicideprolonged diapausevieraslajitlepotilasietokyky
researchProduct

Testing the effectiveness of pyrazine defences against spiders

2020

Insects live in a dangerous world and may fall prey to a wide variety of predators, encompassing multiple taxa. As a result, selection may favour defences that are effective against multiple predator types, or target-specific defences that can reduce predation risk from particular groups of predators. Given the variation in sensory systems and hunting tactics, in particular between vertebrate and invertebrate predators, it is not always clear whether defences, such as chemical defences, that are effective against one group will be so against another. Despite this, the majority of research to date has focused on the role of a single predator species when considering the evolution of defended…

spidersaromaattiset yhdisteetchemical defenceanti-predator defencefungihyönteisethämähäkitpyrazinesinsectspuolustusmekanismit (biologia)täpläsiilikäs
researchProduct