Search results for "ionilähteet"

showing 8 items of 8 documents

Prospects for advanced electron cyclotron resonance and electron beam ion source charge breeding methods for EURISOL

2011

International audience; As the most ambitious concept of isotope separation on line (ISOL) facility, EURISOL aims at producing unprecedented intensities of post-accelerated radioactive isotopes. Charge breeding, which transforms the charge state of radioactive beams from 1+ to an n+ charge state prior to postacceleration, is a key technology which has to overcome the following challenges: high charge states for high energies, efficiency, rapidity and purity. On the roadmap to EURISOL, a dedicated R&D is being undertaken to push forward the frontiers of the present state-of-the-art techniques which use either electron cyclotron resonance or electron beam ion sources. We describe here the gui…

[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Cyclotron resonanceplasmafysiikka01 natural sciences7. Clean energyElectron cyclotron resonanceIonlaw.inventionIsotope separationelectron beamsNuclear physicsEURISOLion sourceslaw0103 physical sciencescyclotron resonance010306 general physicsradioactive ion beamsradioactive beamInstrumentation010302 applied physicsPhysicsta11429.25.Ni 41.75.Fr 07.77.KaionilähteetParticle acceleratorradioaktiiviset suihkutIon sourceCathode rayAtomic physicsydinfysiikkaIon cyclotron resonance
researchProduct

ECR-ionilähteiden plasmapotentiaali ja ambipolaarinen diffuusio

2005

ionitECR-ionilähteetplasmapotentiaaliplasmatekniikkafysiikkaambipolaarinen diffuusio
researchProduct

Photo-enhanced O−, H− and Br− ion production in caesium sputter negative ion source : no evidence for resonant ion pair production

2022

It has been proposed that the negative ion yield of a caesium sputter ion source could be enhanced by promoting neutral caesium atoms to electronically excited 7p states supporting resonant ion pair production. We have tested this hypothesis by illuminating the cathode of a caesium sputter ion source with an adjustable wavelength laser and measuring its effect on the extracted beam currents of O−, H− and Br− anions. The laser exposure causes the beam currents to increase but the effect is independent of the wavelength in the range of 440-460 nm, which leads us to conclude that there is no evidence for resonant ion pair production. The photon-induced beam current enhancement scales with the …

ionitcesiumionilähteethiukkaskiihdyttimetlasersäteily
researchProduct

Quasi-periodical kinetic instabilities in minimum-B confined plasma

2022

We present the results of an experimental investigation of quasi-periodical kinetic instabilities exhibited by magnetically confined electron cyclotron resonance heated plasmas. The instabilities were detected by measuring plasma microwave emission, electron losses, and wall bremsstrahlung. The instabilities were found to be grouped into fast sequences of periodic plasma losses, separated by ∼100 µs between the bursts, followed by 1–10 ms quiescent periods before the next event. Increasing the plasma energy content by adjusting the plasma heating parameters, in particular the magnetic field strength, makes the instabilities more chaotic in the time domain. Statistical analysis reveals that …

plasma confinemention sourcessyklotronitPhysicsQC1-999ECR-ionilähteetGeneral Physics and Astronomyplasma heatingplasma instabilitiescyclotron resonancehiukkaskiihdyttimetplasmafysiikkaAIP Advances
researchProduct

Recent progress on the superconducting ion source VENUS.

2012

The 28 GHz Ion Source VENUS (versatile ECR for nuclear science) is back in operation after the superconducting sextupole leads were repaired and a fourth cryocooler was added. VENUS serves as an R&D device to explore the limits of electron cyclotron resonance source performance at 28 GHz with its 10 kW gryotron and optimum magnetic fields and as an ion source to increase the capabilities of the 88-Inch Cyclotron both for nuclear physics research and applications. The development and testing of ovens and sputtering techniques cover a wide range of applications. Recent experiments on bismuth demonstrated stable operation at 300 eμA of Bi31+, which is in the intensity range of interest for hig…

plasma fysiikkaMaterials scienceta114biologybusiness.industryionilähteetCyclotronParticle acceleratorVenusCryocoolerplasmafysiikkabiology.organism_classificationElectron cyclotron resonanceFourier transform ion cyclotron resonanceIon sourcelaw.inventionOpticslawIon sourcesAtomic physicsbusinessInstrumentationIon cyclotron resonanceThe Review of scientific instruments
researchProduct

The electron cyclotron resonance ion source with arc-shaped coils concept

2012

The main limitation to further improve the performance of ECR ion sources is set by the magnet technology related to the multipole magnet field used for the closed minimum-B structure. The JYFL ion source group has sought different approaches to improve the strength of the minimum-B structure required for the production of highly charged ion beams. It was found out that such a configuration can be realized with arc shaped coils. The first prototype, electron cyclotron resonance ion source with arc-shaped coils (ARC-ECRIS), was constructed and tested at JYFL in 2006. It was confirmed that such an ion source can be used for the production of highly charged ion beams. Regardless of several cos…

plasma fysiikkaionilähteetIon sourcesplasmafysiikka
researchProduct

VUV-diagnostics of low temperature hydrogen plasmas

2015

vacuum ultraviolet emission spectroscopyplasma diagnosticsvetyplasma (kaasu)ionilähteetspektroskopiaultraviolettisäteilyion sourceplasmafysiikkalow temperature hydrogen plasmaemissio (fysiikka)
researchProduct

Hydrogen plasma induced photoelectron emission from metal surfaces

2018

Low temperature hydrogen plasmas are strong sources of vacuum ultraviolet radiation. The properties of laboratory plasmas can be influenced by surface processes induced by photons with their energies exceeding the surface work function of the wall material. In this work, the plasma induced photoelectron emission has been studied with different ion sources. The emission depends on the mechanical design of the plasma device, plasma heating method and the discharge power (density). Parametric studies include the quantifying of the emission from different metal surfaces, commonly used as plasma facing materials in ion sources, as well as alkali metal covered surfaces. Experimental studies sugges…

valosähköinen ilmiöPhysics::Plasma Physicsplasma (kaasu)Physics::Space Physicsionilähteetphotoelectron emissionion sourceplasmafysiikkalow temperature hydrogen plasma
researchProduct