Search results for "kappa"

showing 10 items of 419 documents

Inter- and Intraobserver Variation in the Assessment of Preoperative Colostograms in Male Anorectal Malformations: An ARM-Net Consortium Survey

2020

Aim:Male patients with anorectal malformations (ARM) are classified according to presence and level of the recto-urinary fistula. This is traditionally established by a preoperative high-pressure distal colostogram that may be variably interpreted by different surgeons. The aim of this study was to evaluate the inter- and intraobserver variation in the assessment by pediatric surgeons of preoperative colostograms with respect to the level of the recto-urinary fistula. Materials and Methods:Sixteen pediatric surgeons from 14 European centers belonging to the ARM-Net Consortium twice scored 130 images of distal colostograms taken in sagittal projection at a median age of 66 days of life (rang…

diagnostic studymedicine.medical_specialtyFistulaanorectal malformationRare cancers Radboud Institute for Molecular Life Sciences [Radboudumc 9]030204 cardiovascular system & hematologyPediatricssurgery03 medical and health sciencesAll institutes and research themes of the Radboud University Medical Center0302 clinical medicineBOWEL FUNCTIONUrinary Fistula030225 pediatricsMANAGEMENTMedicineddc:610Intraobserver VariationOriginal Researchcolostogramanorectal malformation urinary fistula colostogram surgery ARM-net multirater agreement radiology diagnostic studybusiness.industryARM-netlcsh:RJ1-570Pediatric Surgeonlcsh:PediatricsFISTULAmedicine.diseaseradiologySagittal planeReconstructive and regenerative medicine Radboud Institute for Health Sciences [Radboudumc 10]multirater agreementReconstructive and regenerative medicine Radboud Institute for Molecular Life Sciences [Radboudumc 10]medicine.anatomical_structureHomogeneousPRESSURE DISTAL COLOSTOGRAMInterobserver VariationPediatrics Perinatology and Child HealthUPDATEurinary fistulaRadiologyanorectal malformation; ARM-net; colostogram; diagnostic study; multirater agreement; radiology; surgery; urinary fistulabusinessKappa
researchProduct

Role of quercetin on sterigmatocystin-induced oxidative stress-mediated toxicity.

2021

Oxidative stress appears to be a common trigger for many of the effects associated with the exposure to various mycotoxins, including sterigmatocystin (STE). However, studies to alleviate STE toxicity through the use of natural antioxidants are sparsely reported in literature. In the present study, the cytoprotective effect of quercetin (QUE) was tested in SH-SY5Y cells against STE-induced oxidative stress and cytotoxicity. The MTT assay revealed that STE decreased cell viability, whereas pre-treatment of cells with QUE restored it. The QUE was also found to counteract STE-induced ROS generation and decrease STE-induced up-regulation of the expression of the stress-inducible enzymes HO-1 an…

endocrine systemCell SurvivalSterigmatocystinInflammationPharmacologyToxicologymedicine.disease_causeAntioxidantsImmunomodulationchemistry.chemical_compoundCell Line TumormedicineHumansMTT assayViability assayCytotoxicityInflammationChemistryNF-kappa BNF-κBGeneral MedicineOxidative StressGene Expression RegulationToxicityQuercetinmedicine.symptomOxidative stressBiomarkersFood ScienceSterigmatocystinFood and chemical toxicology : an international journal published for the British Industrial Biological Research Association
researchProduct

Development and validation of new methods for the study of oxidative stress by Imaging Flow Cytometry

2017

El estrés oxidativo se origina debido a un desequilibrio entre la producción de especies reactivas de oxígeno (ROS) y los mecanismos celulares antioxidantes. Este desequilibrio en el estado normal redox puede causar efectos tóxicos a través de la producción de radicales libres y peróxidos, que dañan a componentes esenciales de la célula, como proteínas, lípidos y ADN. Actualmente se cree que el estrés oxidativo está relacionado con los mecanismos en un gran número de enfermedades degenerativas y cáncer, y también se le atribuye un papel importante en el proceso de envejecimiento. En algunos casos, la producción de especies reactivas de oxígeno (ROS) no es un fenómeno indeseable sino que for…

image flow cytometrynuclear factor kappa-bUNESCO::CIENCIAS MÉDICASflow Cytometryphagocytosisoxidative stress:CIENCIAS MÉDICAS [UNESCO]
researchProduct

Tolerance and M2 (alternative) macrophage polarization are related processes orchestrated by p50 nuclear factor {kappa}B.

2009

Cells of the monocyte-macrophage lineage play a central role in the orchestration and resolution of inflammation. Plasticity is a hallmark of mononuclear phagocytes, and in response to environmental signals these cells undergo different forms of polarized activation, the extremes of which are called classic or M1 and alternative or M2. NF-kappaB is a key regulator of inflammation and resolution, and its activation is subject to multiple levels of regulation, including inhibitory, which finely tune macrophage functions. Here we identify the p50 subunit of NF-kappaB as a key regulator of M2-driven inflammatory reactions in vitro and in vivo. p50 NF-kappaB inhibits NF-kappaB-driven, M1-polariz…

in vivoinflammationp50 NF-κB macrophage polarizationin vitroM1 (classic) macrophageM2 (alternative) macrophagep50 nuclear factor KappaB
researchProduct

"Table 5" of "Global baryon number conservation encoded in net-proton fluctuations measured in Pb-Pb collisions at $\sqrt{s_{\rm NN}}$ = 2.76 TeV"

2020

Measured first cumulants of protons.

kappa1(p)1276.0Nuclear TheoryPhysics::Accelerator PhysicsPbPbNuclear Experiment
researchProduct

Fattig men stolt : en svensk lägre prästs liv under 1830-1850-talen enligt stadskomminister Olof Evert August Hermanssons dagbok (1838-1850)

1999

kappalainenpapin vaimoapupappisisustusRuotsinautintoainekulttuurisosiaaliset verkostotalempi papistopapistopappilakulttuuriruokakulttuuriseuraelämäpappilatvapaa-aika1800-luku
researchProduct

Developments in many-body theory of quantum transport and spectroscopy with non-equilibrium Green's functions and time-dependent density functional t…

2015

The problem of quantum dynamics in open systems has gained attention in recent decades and not the least due to the advances made in quantum transport in molecular systems. The main motivation behind quantum transport and molecular electronics is the futuristic goal to be able at some point to replace, or to complement, the silicon-based technology and to make the electronic devices faster. On a fundamental level, one has to deal with time-dependent processes where electron-electron or electron- phonon interactions are of great importance, and they can cause profound quantitative and qualitative changes on the physical and dynamical properties of electronic systems compared to the non-inter…

kvanttikuljetuselektronikorrelaationanoelektroniikkatiheysfunktionaaliteoriamonen kappaleen häiriöteoriaGreenin funktiokvanttikemiakvanttimekaniikkakvanttifysiikkamolekyylielektroniikkaelektronittiheysmatriisirenormalisaatioryhmädynamiikka
researchProduct

Kämmensyrjävaimennus muodon artikuloijana : sen aikaansaamat muutokset heavy metal-musiikin rytmiikassa, sointivärissä ja harmoniassa

2011

Kämmensyrjävaimennus (engl. palm-mute) on eräs musiikkikappaleen muotoa artikuloiva tekijä, sillä se saa aikaan muutoksia rytmiikassa, harmoniassa ja sointivärissä. Tästä huolimatta sen huomioiminen populaarimusiikintutkimuksessa on ollut varsin vähäistä. Käyn tutkimuksessani läpi kämmensyrjävaimennuksen eri ilmenemismuotoja ja niiden suhdetta heavy metal -musiikin muotokäsitykseen. Tutkimukseni tulokset esitän kämmensyrjävaimennuksen ja hypermetriikkaan ja modulaariseen strukturointiin perustuvan muotokäsityksen teoreettisen taustan, keräämäni aineiston ja musiikkianalyyttisten menetelmien avulla. Käsittelen myös tutkimuksessani kriittisesti perinteisen musiikin muotokäsityksen soveltuvuut…

kämmensyrjävaimennusmodulaarinen strukturointihypermetriikkamusiikkikappaleen muodon artikulaatiotoistopalm-mute
researchProduct

IFI16 expression is related to selected transcription factors during B-cell differentiation

2015

The interferon-inducible DNA sensor IFI16 is involved in the modulation of cellular survival, proliferation, and differentiation. In the hematopoietic system, IFI16 is consistently expressed in the CD34+ stem cells and in peripheral blood lymphocytes; however, little is known regarding its regulation during maturation of B- and T-cells. We explored the role of IFI16 in normal B-cell subsets by analysing its expression and relationship with the major transcription factors involved in germinal center (GC) development and plasma-cell (PC) maturation.IFI16mRNA was differentially expressed in B-cell subsets with significant decrease inIFI16mRNA in GC and PCs with respect to naïve and memory subs…

lcsh:Immunologic diseases. AllergyAdultMaleXBP1Article SubjectLymphoid TissueTranscription FactorCellular differentiationPlasma CellsImmunologyB-Lymphocyte SubsetsBiologySettore MED/08 - Anatomia PatologicaAdult; B-Lymphocyte Subsets; B-Lymphocytes; Enzyme Activation; Female; Gene Expression Profiling; Germinal Center; Humans; Lymphoid Tissue; Male; NF-kappa B; Nuclear Proteins; Phosphoproteins; Plasma Cells; RNA Messenger; Transcription Factors; Cell Differentiation; Gene Expression Regulation; Immunology; Immunology and AllergyGene expressionImmunology; Immunology and AllergyHumansImmunology and AllergyRNA MessengerTranscription factorB-Lymphocyte SubsetsNuclear ProteinRegulation of gene expressionB-Lymphocyte SubsetB-LymphocytesRELBGene Expression ProfilingB-LymphocyteNF-kappa BNuclear ProteinsCell DifferentiationGeneral MedicineB-Cell DifferentiationPhosphoproteinsGerminal CenterMolecular biologyGene expression profilingEnzyme ActivationGene Expression RegulationPhosphoproteinImmunology interferon-inducible DNA sensor IFI16 B-Cell DifferentiationPlasma Cellinterferon-inducible DNA sensor IFI16Femalelcsh:RC581-607Transcription FactorsResearch ArticleHuman
researchProduct

Catching allergy by a simple questionnaire

2014

Background Identifying allergic rhinitis requires allergy testing, but the first-line referral for rhinitis are usually primary care physicians (PCP), who are not familiar with such tests. The availability of easy and simple tests to be used by PCP to suggest allergy should be very useful. Methods The Respiratory Allergy Prediction (RAP) test, based on 9 questions and previously validated by a panel of experts, was evaluated in this study. Results An overall number of 401 patients (48.6% males, age range 14–62 years) with respiratory symptoms was included. Of them, 89 (22.2%) showed negative results to SPT, while 312 (77.8%) had at least one positive result to SPT. Cohen’s kappa coefficient…

lcsh:Immunologic diseases. AllergyPulmonary and Respiratory MedicinePediatricsmedicine.medical_specialtyAllergyReferralAllergymedicine.medical_treatmentImmunologyAllergy testingPrimary careAllergy testingSettore MED/10 - Malattie Dell'Apparato RespiratorioPharmacistsAllergic rhinitisCohen's kappaAllergic rhinitimedicineImmunology and AllergyOriginal Researchbusiness.industrymedicine.diseaseAllergic rhinitis; Allergy; Allergy testing; Pharmacists; Primary care physicians; Immunology and AllergyTest (assessment)Primary care physicianNasal sprayPharmacistPrimary care physiciansAllergistslcsh:RC581-607business
researchProduct