Search results for "kl"

showing 10 items of 5772 documents

Henri Drouot et la question du folklore

2016

International audience

[ SHS.HIST ] Humanities and Social Sciences/History[SHS.HIST] Humanities and Social Sciences/HistoryHenri Drouotfolklore[SHS.HIST]Humanities and Social Sciences/HistoryComputingMilieux_MISCELLANEOUS
researchProduct

Adaptative biochemical pathways and regulatory networks in Klebsiella oxytoca BAS-10 producing a biotechnologically relevant exopolysaccharide during…

2012

Abstract Background A bacterial strain previously isolated from pyrite mine drainage and named BAS-10 was tentatively identified as Klebsiella oxytoca. Unlikely other enterobacteria, BAS-10 is able to grow on Fe(III)-citrate as sole carbon and energy source, yielding acetic acid and CO2 coupled with Fe(III) reduction to Fe(II) and showing unusual physiological characteristics. In fact, under this growth condition, BAS-10 produces an exopolysaccharide (EPS) having a high rhamnose content and metal-binding properties, whose biotechnological applications were proven as very relevant. Results Further phylogenetic analysis, based on 16S rDNA sequence, definitively confirmed that BAS-10 belongs t…

Proteomicsmetal binding exopolysaccharideRhamnoseeducationlcsh:QR1-502BioengineeringSettore BIO/19 - Microbiologia GeneraleFerric CompoundsApplied Microbiology and BiotechnologyCitric Acidlcsh:Microbiology03 medical and health scienceschemistry.chemical_compoundAcetic acidRNA Ribosomal 16SGene Regulatory NetworksPhylogeny030304 developmental biology2. Zero hunger0303 health sciencesbiology030306 microbiologyResearchKlebsiella oxytocaKlebsiella oxytocabiology.organism_classificationBacterial strainKlebsiella oxytoca; 2D-DIGE analysis; metal binding exopolysaccharide;Metabolic pathwaychemistryBiochemistryFermentation2D-DIGE analysiFermentationEnergy sourceCitric acidMetabolic Networks and PathwaysBiotechnology
researchProduct

The behaviour of REEs in Thailand's Mae Klong estuary: Suggestions from the Y/Ho ratios and lanthanide tetrad effects

2007

Abstract The concentrations of Rare Earth Elements and yttrium (REY) were measured in dissolved phase, in suspended particulate matter (SPM) and in sediments in seven sampling stations in the Mae Klong estuarine system (Inner Thailand Gulf) in order to study their behaviour and distribution pattern. The analysed samples generally show high Rare Earth Element (REE) content in the dissolved phase, with high Medium Rare Earth Elements (MREEs) and Y enrichments in the shale-normalized pattern (versus PAAS). These chemical features are interpreted in terms of direct influences of weathering processes of REE-rich minerals (e.g., phosphates), which abundantly out-crop in the Mae Klong watershed. T…

Rare-earth elementSettore AGR/13 - Chimica Agrariachemistry.chemical_elementMineralogyWeatheringFractionationYttriumAuthigenicAquatic ScienceParticulatesOceanographyAdsorptionchemistryAluminosilicateEnvironmental chemistryGeologyrare earth elementstetrad effectY/Ho ratioMae Klong RiverGulf of ThailandEstuarine, Coastal and Shelf Science
researchProduct

An Adaptive Alternating Direction Method of Multipliers

2021

AbstractThe alternating direction method of multipliers (ADMM) is a powerful splitting algorithm for linearly constrained convex optimization problems. In view of its popularity and applicability, a growing attention is drawn toward the ADMM in nonconvex settings. Recent studies of minimization problems for nonconvex functions include various combinations of assumptions on the objective function including, in particular, a Lipschitz gradient assumption. We consider the case where the objective is the sum of a strongly convex function and a weakly convex function. To this end, we present and study an adaptive version of the ADMM which incorporates generalized notions of convexity and penalty…

Control and Optimizationsignal denoisingApplied Mathematicsalternating direction method of multipliersMathematics::Optimization and Controldouglas–rachford algorithmUNESCO::CIENCIAS TECNOLÓGICASManagement Science and Operations Researchcomonotonicityweakly convex functionOptimization and Control (math.OC)47H05 47N10 47J25 49M27 65K15FOS: Mathematicsfirm thresholdingMathematics - Optimization and Control
researchProduct

Plasma diagnostic tools for ECR ion sources : What can we learn from these experiments for the next generation sources

2019

International audience; The order-of-magnitude performance leaps of ECR ion sources over the past decades result from improvements to the magnetic plasma confinement, increases in the microwave heating frequency, and techniques to stabilize the plasma at high densities. Parallel to the technical development of the ion sources themselves, significant effort has been directed into the development of their plasma diagnostic tools. We review the recent results of Electron Cyclotron Resonance Ion Source (ECRIS) plasma diagnostics highlighting a number of selected examples of plasma density, electron energy distribution, and ion confinement time measurements, obtained mostly with the second-gener…

[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Solenoidmagnetic fieldshiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesbremsstrahlungElectron cyclotron resonance010305 fluids & plasmasIonoptical emission spectroscopySuperposition principleion sourcesPhysics::Plasma Physics0103 physical sciencesInstrumentation010302 applied physicsPhysics[PHYS]Physics [physics]plasma confinementplasma properties and parametersplasma diagnosticssyklotronitplasma heatingPlasmaIon sourceComputational physicsMagnetic fieldPlasma diagnostics
researchProduct

Dry chlorination of spent nickel metal hydride battery waste for water leaching of battery metals and rare earth elements

2022

An efficient leaching process was developed for nickel, cobalt, and the rare earth elements (REEs) from spent nickel metal hydride (NiMH) battery waste. The process involves dry chlorination with ammonium chloride in low temperature to produce water-soluble chlorinated compounds, followed by simple water leaching. The factors affecting the conversion and solubilization were studied, including the amount of ammonium chloride, residence time and temperature in dry chlorination, and solid to liquid ratio, time and temperature in water leaching. As a result, the dry chlorination process was found to produce ammonium and chloride containing products, depending on the temperature of the process: …

prosessitkloriditProcess Chemistry and TechnologyNiMHharvinaiset maametallitPollutionakutympäristöystävällisyysdry chlorinationnikkelimetallihydridiakutjätteiden hyötykäyttöliuotusbatteryChemical Engineering (miscellaneous)kobolttinikkeliWaste Management and Disposal
researchProduct

Psychosocial Risks, Work Engagement, and Job Satisfaction of Nurses During COVID-19 Pandemic

2020

Context:COVID-19 pandemic is a serious health emergency that has affected countries all over the world. Health emergencies are a critical psychosocial risk factor for nurses. In general, psychosocial risks constitute serious problems as they impact workers' health, productivity, and efficiency. Despite their importance, few studies analyze nurses' psychosocial risks during a health emergency caused by a pandemic or analyze their perception of the emergency and its relation to such risks.Objectives:To analyze the perception of COVID-19 by nurses, especially about measures, resources, and impact on their daily work. Also, to analyze these professionals' psychosocial risks and the relationship…

AdultMalework engagementgenetic structuresProtective factornurseContext (language use)WorkloadNursing Staff HospitalJob Satisfaction03 medical and health sciences0302 clinical medicineNursingRisk Factorspeak pandemicSurveys and Questionnaires0502 economics and businessHumansjob insecurity030212 general & internal medicineBurnout ProfessionalPandemicsOriginal ResearchSARS-CoV-2Work engagementlcsh:Public aspects of medicine05 social sciencesPublic Health Environmental and Occupational HealthCOVID-19Emotion workWorkloadpsychosocial riskslcsh:RA1-1270Risk factor (computing)Middle AgedSpainJob satisfactionFemalePublic HealthPsychologyPsychosocial050203 business & managementFrontiers in Public Health
researchProduct

Norm, essential norm and weak compactness of weighted composition operators between dual Banach spaces of analytic functions

2017

Abstract In this paper we estimate the norm and the essential norm of weighted composition operators from a large class of – non-necessarily reflexive – Banach spaces of analytic functions on the open unit disk into weighted type Banach spaces of analytic functions and Bloch type spaces. We also show the equivalence of compactness and weak compactness of weighted composition operators from these weighted type spaces into a class of Banach spaces of analytic functions, that includes a large family of conformally invariant spaces like BMOA and analytic Besov spaces.

Discrete mathematicsMathematics::Functional AnalysisApplied MathematicsTopological tensor product010102 general mathematicsEberlein–Šmulian theoremWeakly compact operatorBloch type spaceBanach manifoldFinite-rank operator01 natural sciences010101 applied mathematicsEssential normWeighted spaces of analytic functionsFréchet spaceWeighted composition operatorInterpolation spaceBirnbaum–Orlicz space0101 mathematicsLp spaceAnalysisMathematics
researchProduct

Do patients with gastroesophageal reflux disease and somatoform tendencies benefit from antireflux surgery?

2019

Source at http://dx.doi.org/10.3748/wjg.v25.i3.388. BACKGROUND - The clinical presentation of gastroesophageal reflux disease (GERD) shows a large symptom variation also in different intensities among patients. As several studies have shown, there is a large overlap in the symptomatic spectrum between proven GERD and other disorders such as dyspepsia, functional heartburn and/or somatoform disorders. AIM - To prospectively evaluate the GERD patients with and without somatoform disorders before and after laparoscopic antireflux surgery. METHODS - In a tertiary referral center for foregut surgery over a period of 3 years patients with GERD, qualifying for the indication of laparoscopic antire…

AdultMalemedicine.medical_specialtyPsychometricsFundoplicationDiseaseLaparoscopic fundoplicationGastroesophageal reflux disease03 medical and health sciencesYoung Adult0302 clinical medicineQuality of lifeInternal medicineVDP::Medical disciplines: 700::Clinical medical disciplines: 750::Gastroscopic surgery: 781medicineHumansddc:610Prospective StudiesYoung adultAntireflux surgeryLaparoscopyProspective cohort studySomatoform DisordersVDP::Medisinske Fag: 700::Klinisk medisinske fag: 750::Gasteroenterologisk kirurgi: 781AgedAged 80 and overmedicine.diagnostic_testbusiness.industryGastroenterologyRefluxGeneral MedicineMiddle Agedmedicine.diseasehumanitiesdigestive system diseasesTreatment OutcomeSomatization030220 oncology & carcinogenesisGERDGastroesophageal RefluxQuality of LifeProspective Study030211 gastroenterology & hepatologyFemaleLaparoscopybusinessSomatizationGastroesophageal reflux disease symptomsWorld Journal of Gastroenterology
researchProduct

Associations between changes in physical fitness and psychological difficulties status among Norwegian adolescents

2021

Abstract Objectives To investigate the associations for one-year changes in cardiorespiratory fitness, muscular strength and body mass index, with psychological difficulties status in adolescents. Methods Norwegian 14-15-year-olds (n = 925) participated in data collection at two time points separated by one year. Psychological difficulties were assessed via the Strengths and Difficulties questionnaire and data from follow-up serve as the dependent variable. Cardiorespiratory fitness (the Andersen-test), muscular strength (Eurofit) and body mass index were measured. Change scores were calculated from the physical fitness variables and serve as independent variables in linear mixed effects mo…

business.industrypsykisk helsePhysical fitnessCardiorespiratory fitnessNorwegianStrengths and Difficulties Questionnairemental helseVDP::Medisinske Fag: 700::Idrettsmedisinske fag: 850fysisk aktivitet:Medisinske Fag: 700::Klinisk medisinske fag: 750::Psykiatri barnepsykiatri: 757 [VDP]Physical strengthlanguage.human_languagePsychiatry and Mental healthlanguageAssociation (psychology)businessPsychology:Samfunnsvitenskap: 200::Samfunnsvitenskapelige idrettsfag: 330 [VDP]Socioeconomic statusBody mass indexApplied PsychologyClinical psychologyMental Health and Physical Activity
researchProduct