Search results for "kuntoliikunta"

showing 10 items of 126 documents

Musculoskeletal Responses to Exercise Plus Nutrition in Men with Prostate Cancer on Androgen Deprivation: A 12-Month RCT

2021

PURPOSE Androgen deprivation therapy (ADT) for prostate cancer has multiple adverse effects on musculoskeletal health. This 12-month randomized controlled trial aimed to assess the effects of multicomponent exercise training combined with whey protein, calcium and vitamin D supplementation on bone mineral density (BMD), structure and strength, body composition, muscle strength, and physical function in ADT-treated men. METHODS Seventy ADT-treated men were randomized to exercise plus supplementation (Ex + Suppl; n = 34) or usual care (control; n = 36). Ex + Suppl involved thrice weekly progressive resistance training plus weight-bearing impact exercise with daily multinutrient supplementatio…

Malemedicine.medical_specialtymusclelihaksetPhysical Therapy Sports Therapy and Rehabilitationandrogen deprivation therapybonelaw.inventionravintoAndrogen deprivation therapyProstate cancerRandomized controlled trialBone DensitylawInternal medicinemedicinecancerHumansOrthopedics and Sports MedicineMuscle StrengthVitamin DAdverse effectAgedFemoral neckBone mineralluustoexercisesyöpähoidoteturauhassyöpäkuntoliikuntabusiness.industryProstatic NeoplasmsAndrogen Antagonistsmedicine.diseaseConfidence intervalExercise TherapyCalcium DietarynutritionWhey Proteinsmedicine.anatomical_structureDietary SupplementsBody CompositionLean body massPatient CompliancesyöpätauditbusinessBiomarkersMedicine & Science in Sports & Exercise
researchProduct

A Smartphone App to Promote Healthy Weight Gain, Diet, and Physical Activity During Pregnancy (HealthyMoms): Protocol for a Randomized Controlled Tri…

2019

BACKGROUND: Excessive gestational weight gain is common and associated with adverse outcomes both in the short and long term. Although traditional lifestyle-based interventions have shown to mitigate excess gestational weight gain, little is known about whether mobile Health (mHealth) apps can promote healthy weight gain, diet, and physical activity during pregnancy. OBJECTIVE: The primary aim of the HealthyMoms trial is to determine the effectiveness of a smartphone app (HealthyMoms) for mitigating excess gestational weight gain during pregnancy. Secondary aims are to determine the effectiveness of the app on dietary habits, physical activity, body fatness, and glycemia during pregnancy. M…

Original Papermobile phoneNutrition and DieteticsexercisekuntoliikuntaraskaussmartphonepainonhallintatelelääketiedeNäringsläragestational weight gainmobiilisovelluksettelemedicinepregnancyteleterveydenhuoltodietJMIR Research Protocols
researchProduct

Training During the COVID-19 Lockdown: Knowledge, Beliefs, and Practices of 12,526 Athletes from 142 Countries and Six Continents

2021

Abstract Objective Our objective was to explore the training-related knowledge, beliefs, and practices of athletes and the influence of lockdowns in response to the coronavirus disease 2019 (COVID-19) pandemic caused by severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2). Methods Athletes (n = 12,526, comprising 13% world class, 21% international, 36% national, 24% state, and 6% recreational) completed an online survey that was available from 17 May to 5 July 2020 and explored their training behaviors (training knowledge, beliefs/attitudes, and practices), including specific questions on their training intensity, frequency, and session duration before and during lockdown (March–Jun…

PANDEMIASmedicine.medical_specialtySports medicine[SHS.EDU]Humanities and Social Sciences/EducationeducationPhysical Therapy Sports Therapy and RehabilitationCoachingInterval trainingIntensity Frequency Session durationAthletic training[SDV.MHEP.PHY]Life Sciences [q-bio]/Human health and pathology/Tissues and Organs [q-bio.TO]medicineHumansPlyometricsharjoitteluOrthopedics and Sports MedicineOriginal Research ArticlevalmennusPandemicsGeneral fitness trainingbiologySARS-CoV-2business.industryAthleteskuntoliikuntaCOVID-19biology.organism_classificationMental healthC600AthletespoikkeusolotCommunicable Disease Control0913 Mechanical Engineering 1106 Human Movement and Sports Sciences 1302 Curriculum and PedagogyPhysical therapy[SDV.SPEE]Life Sciences [q-bio]/Santé publique et épidémiologieAthletes/psychology; COVID-19; Communicable Disease Control; Humans; Pandemics; SARS-CoV-2businessSport Sciencesurheilijathuippu-urheilijat
researchProduct

Relationships of leisure-time physical activity and work ability between different occupational physical demands in adult working men

2019

Purpose: Leisure-time physical activity (LTPA) is known to be associated with positive health benefits, but the role of occupational physical demands remains inconsistent. The purpose of the current study was to assess the relationship between LTPA and work ability in different occupational physical activity (OPA) levels between young adult men. - Methods: We performed physical activity measurements in work and leisure time with the long version of International Physical Activity Questionnaire (IPAQ) and work ability with the Work Ability Index (WAI) in 921 Finnish employed male volunteer participants. The participants were divided into LTPA tertiles I ( 28 MET-h/week) and OPA tertiles I (0…

QuestionnairesMaleGerontologymedicine.medical_treatmentLeisure timephysical activityACTIVITY QUESTIONNAIREHealth benefitsOccupational safety and health0302 clinical medicineSurveys and Questionnairestyökyky030212 general & internal medicine315 Sport and fitness sciencesYoung adultFinlandRehabilitationexercisekuntoliikuntaPAINASSOCIATION030210 environmental & occupational health3142 Public health care science environmental and occupational healthHEALTH-BENEFITSCARDIOVASCULAR-DISEASEMETmiehetEMPLOYEESOriginal ArticlePsychologyfyysinen aktiivisuusvapaa-aikaAdultPhysical activityWork Capacity Evaluationoccupational physical demandsleasure-time03 medical and health sciencesLeisure ActivitiesmedicineHumansExerciseSelf-efficacyOccupational healthtyöterveysDISABILITYPublic Health Environmental and Occupational HealthSELF-EFFICACYOccupational physical demands3141 Health care scienceCross-Sectional Studiestyön kuormittavuusOSTEOARTHRITISWork abilityhuman activitiesInternational Archives of Occupational and Environmental Health
researchProduct

Daily moods, health routines and recovery among employees working in the retail and services sector : A diary study

2022

This study examined the quality and fluctuation of daily moods as well as health routines and means of recovery from work strain among employees (n = 38) working nonstandard, often unpredictable schedules in the retail and services sector in Finland. Data were collected via a background questionnaire and a one-week mobile diary. The results indicated that the daily moods of employees were relatively positive but varied greatly from day to day. Hectic working days, unpredictable changes in work schedules, and compounded responsibilities at home and work were reported as causes of daily strain stemming from work. In contrast, more sleep and exercise were positively associated with daily mood …

Sociology and Political Sciencetyön kuormittavuuspsyykkinen kuormittavuuskuntoliikuntaterveyskäyttäytyminenmielialapalautuminentottumuksetpalvelualakauppa-alauni (lepotila)fyysinen kuormittavuusepätyypillinen työ
researchProduct

Predicting accelerometer-based physical activity in physical education and total physical activity: The Self-determination Theory approach

2019

The present study tested the motivational model of physical education (PE) including needs for competence, autonomy, social relatedness, intrinsic and extrinsic motivation, in-class moderate to vigorous physical activity (MVPA), and total MVPA. Participants were 490 (264 girls, 226 boys) Finnish elementary school students. The data were collected using accelerometers and questionnaires for a seven-day period during the fall semester 2017. The key findings were that 1) social relatedness associated with total MVPA via in-class MVPA in girls, whereas competence was linked to in-class MVPA through extrinsic motivation in boys, 2) competence was positively linked to extrinsic motivation in a si…

Total physical activitySchoolmedia_common.quotation_subjectschooleducationPhysical activityExercise motivationPhysical Therapy Sports Therapy and Rehabilitation030204 cardiovascular system & hematologystructural equation modellingStructural equation modelingDevelopmental psychologyPhysical education03 medical and health sciences0302 clinical medicinekoululiikuntaEducación Física y DeportivaIntrinsic motivationlcsh:Sports medicineCompetence (human resources)media_commonmotivaatiokuntoliikuntaSelf030229 sport sciencesexercise motivationpsychological needsPsychological needsliikuntapsykologiaStructural equation modellingPsychologylcsh:RC1200-1245human activitiesAutonomyfyysinen aktiivisuus
researchProduct

Miten suomalaisia on kannustettu liikkumaan?

2020

Ylös ulos ja lenkille! Suomalaiset kuntoliikuntajärjestöt ja liikuntakampajajulisteet vuosina 1941–2010kirja-arvostelutkuntoliikuntasuomalaisetliikuntakampanjatRantala Maria
researchProduct

Active and passive recovery influence responses of luteinizing hormone and testosterone to a fatiguing strength loading

2018

The purpose of this study was to examine the acute hormonal and muscular responses to a strenuous strength loading [bilateral leg press (LP) 10x10 1RM] followed by loading-specific active (AR, n = 7, LP 10x10x30% 1RM) or passive (PR, n = 11, seated) recovery. The subjects were men age: 26±4 years, height: 174±8 cm, body mass: 75±13 kg. After control measurements, experimental measurements were conducted at pre and post loading as well as post recovery and next morning. A significantly higher absolute concentration (p<0.05) of serum luteinizing hormone (LH) was observed in AR than PR at next morning while no differences were observed in serum testosterone (T), cortisol (C) or sex hormone bin…

active recoverypassive recoveryluteinisoiva hormonilower extremitiesheavy resistance exercisekuntoliikuntapalautuminentestosteronilihaskuntohormonitjalatlihasvoima
researchProduct

Effects of exercise and dietary intervention on serum metabolites in men with insomnia symptoms : a 6-month randomized-controlled trial

2020

Accumulating evidence show that exercise and diet interventions are associated with improved sleep quality. Studies investigating the effects of exercise and dieting on circulating metabolomics in people with sleep disorders, particularly insomnia, are scarce. The present study is a part of a 6-month randomized lifestyle intervention on sleep disorder subjects. Seventy-two Finnish men (aged: 51.6 ± 10.1 years) with chronic insomnia symptoms who were assigned into different intervention groups completed this study (exercise n = 24, diet n = 27 and control n = 21). We found exercise and diet intervention were associated with improved sleep quality and a number of metabolites across different …

aineenvaihduntahäiriötexercisekuntoliikuntainsomniainterventiohoitodietruokavaliotmetabolomicsunettomuusliikuntahoito
researchProduct

Metaboliitit voivat selittää liikuntaharrastuksen verisuonivaikutuksia

2022

ateroskleroosikuntoliikuntaterveysvaikutuksetsydän- ja verisuonitauditaineenvaihduntatuotteetaineenvaihduntafyysinen aktiivisuus
researchProduct