Search results for "lämpötila"

showing 10 items of 81 documents

The effect of a temperature-sensitive prophage on the evolution of virulence in an opportunistic bacterial pathogen.

2022

https://doi.org/10.1111/mec.16638 Abstract Viruses are key actors of ecosystems and have major impacts on global biogeochemical cycles. Prophages deserve particular attention as they are ubiquitous in bacterial genomes and can enter a lytic cycle when triggered by environmental conditions. We explored how temperature affects the interactions between prophages and other biological levels by using an opportunistic pathogen, the bacterium Serratia marcescens, that harbours several prophages and that had undergone an evolution experiment under several temperature regimes. We found that the release of one of the prophages was temperature-sensitive and malleable to evolutionary changes. We furthe…

prophage inductionMARINE VIRUSESbiologiset vaikutuksetviruksetProphagesvirusLIPOPOLYSACCHARIDESEQUENCEbakteriofagitGeneticsBacteriophagesexperimental evolutionPHYSIOLOGYEcology Evolution Behavior and SystematicsEcosystem11832 Microbiology and virologySERRATIA-MARCESCENSepigeneticsVirulenceINDUCTIONopportunistic pathogenTemperatureLYSOGENYekosysteemit (ekologia)taudinaiheuttajatMUTANTSepigenetiikkalämpötilaBACTERIOPHAGERESISTANCEGenome BacterialMolecular ecologyREFERENCES
researchProduct

Measuring phenotypes in fluctuating environments

2020

Despite considerable theoretical interest in how the evolution of phenotypic plasticity should be shaped by environmental variability and stochasticity, how individuals actually respond to these aspects of the environment within their own lifetimes remains unclear. We propose that this understanding has been hampered by experimental approaches that expose organisms to fluctuating environments (typically treatments where fluctuations in the environment are cyclical vs. erratic) for a pre‐determined duration, while ensuring that the mean environment over that the entire exposure period is invariable. This approach implicitly assumes that responses to the mean and variance/predictability in th…

reversible plasticitylämmönsietofungiunpredictable environmentsvesikirputheat tolerancefenotyyppivaihtelulämpötilabet-hedgingthermal toleranceympäristönmuutoksetinsurance
researchProduct

The impact of weather and the phase of the rodent cycle on breeding populations of waterbirds in Finnish Lapland

2016

Climate change may affect bird populations both directly by changing the weather conditions, and indirectly through changes in the food chain. While both theoretical and empirical studies have shown climate change having drastic impacts on polar areas, its consequences on Arctic bird species are still poorly known. Here we investigated how weather and changes in predator–prey interactions affected the annual growth rates of sub-Arctic birds by monitoring the breeding numbers of three duck and seven wader species in the alpine tundra of Finnish Lapland during 2005–2015 (except for 2006). We hypothesized that growth rates of waterbirds would be positively associated with warm and dry weather …

rodent cyclesademääräväestönkasvu1181 Ekologia evoluutiobiologiawaterbirdseducationduckssub-Arcticlämpötilasense organskahlaajat
researchProduct

Warming temperatures and ectoparasitic sea lice impair internal organs in juvenile Atlantic salmon

2021

As a consequence of climate change and open net-pen salmon farming, wild Atlantic salmon Salmo salar are increasingly likely to encounter elevated temperatures and parasite abundances during their early marine migration. Such stressors can compromise fitness by diminishing liver energy stores and impairing cardiac muscle. To assess whether temperature and infestation by salmon lice Lepeophtheirus salmonis are important correlates of liver energy stores and cardiac muscle performance in juvenile salmon, we experimentally infested fish at 3 abundances of louse infestation (zero, low, and high) and 5 temperatures (10, 13, 16, 19, and 22°C). At the end of the experiment (i.e. when sea lice reac…

salmon farmslohiheartparasitismikalatäitilmastonmuutoksetliverclimate changekalanviljelyaquacultureLepeophtheirus salmonisloisetparasitic diseasescardiosomatic indexhepatosomatic indexlämpötilalämpeneminenfysiologiset vaikutukset
researchProduct

The evolution of temperature tolerance and invasiveness in a fluctuating thermal environment

2016

The consequences of the climate change on species are still uncertain, despite of intensive research. Currently, rising temperature is not the only concern, since the climate change scenarios also predict increases in the amount of disturbances, such as storms, floods, and thermal fluctuations. Disturbances have also been shown to affect species’ evolution, for example by selecting for traits that are advantageous in fluctuating environments but are also facilitating invasiveness. In this thesis, I study the consequences of evolving in a fluctuating thermal environment by utilizing bacterial microcosms. First I tested the effects of fluctuating vs. constant temperature on the evolution of t…

sopeutuminenluonnonvalintaevoluutiotemperature fluctuationadaptationilmastonmuutoksetinvasiondisturbed environmentbakteeritinvaasiolajittolerance curvelämpötilaexperimental evolutionvieraslajitkokeellinen evoluutiobacterialeviäminenympäristönmuutokset
researchProduct

Population divergence in maternal investment and embryo energy use and allocation suggests adaptive responses to cool climates

2023

1. The thermal sensitivity of early life stages can play a fundamental role in constraining species distributions. For egg-laying ectotherms, cool temperatures often extend development time and exacerbate developmental energy cost. Despite these costs, egg laying is still observed at high latitudes and altitudes. How embryos overcome the developmental constraints posed by cool climates is crucial knowledge for explaining the persistence of oviparous species in such environments and for understanding thermal adaptation more broadly. 2. Here, we studied maternal investment and embryo energy use and allocation in wall lizards spanning altitudinal regions, as potential mechanisms that enable su…

sopeutuminenmetabolic rateliskotincubation temperaturelevinneisyysembryo retentionthyroid hormonedevelopmental rateilmastomaternal effectslämpötilacost of developmentlajitoffspring size
researchProduct

Implications of heat waves on immune defence, life history traits, and adaptive potential : a snail's perspective

2014

sopeutuminenpeto-saalissuhdeloisalttiuskotilotgenetic covariationinbreedingilmastonmuutoksetimmuunipuolustuslisääntyminenhost-parasite interactiongeneettinen muuntelupiippolimakotiloelinkiertoclimate changecross-generational effectsphenotypic responsesgenetic variationLymnaea stagnalislämpötilalämpöaallotgeneettiset tekijät
researchProduct

Environmental factors modulating cold tolerance, gene expression and metabolism in Drosophila montana

2011

sopeutuminenseasonalitymahlakärpäsetympäristötekijätcold toleranceD. virilislisääntyminenmetabolomicsphenotypic plasticitytalvehtiminenakklimatisaatiokylmänkestävyysDrosophila montanagene expressionhyönteisetkylmyyslämpötilageeniekspressioaineenvaihduntavalovuorokausirytmi
researchProduct

Temperature-dependent mutational robustness can explain faster molecular evolution at warm temperatures, affecting speciation rate and global pattern…

2016

Distribution of species across the Earth shows strong latitudinal and altitudinal gradients with the number of species decreasing with declining temperatures. While these patterns have been recognized for well over a century, the mechanisms generating and maintaining them have remained elusive. Here, we propose a mechanistic explanation for temperature-dependent rates of molecular evolution that can influence speciation rates and global biodiversity gradients. Our hypothesis is based on the effects of temperature and temperature-adaptation on stability of proteins and other catalytic biomolecules. First, due to the nature of physical forces between biomolecules and water, stability of biomo…

species diversitymolecular evolutionmutational robustnesslajiutuminenlämpötila
researchProduct

Spectroscopic studies of semiconducting single-walled carbon nanotubes

2010

The unique nature of optical properties of single-walled carbon nanotubes (SWCNT), together with their promising potential applications, have created enormous interest towards the photophysics of SWCNT. Many aspects of carbon nanotubes originate from the electronic structure of carbon honeycomb lattice and one-dimensionality. SWCNTs exist in various chiral structures and diameters, which the optical and electrical properties are dependent on. It has been discovered that SWCNT excited states are excitonic with strong Coulomb interaction between the electron and the hole. However, many features of excitons are not yet well defined, such as absorption cross-sections, fluorescence quantum yield…

spectroscopycarbon nanotubeskemialliset reaktiothiilinanoputketabsorbtiospektroskopiafluoresenssiexciton dynamicsfluorescence spectroscopyfysikaalinen kemiaCondensed Matter::Mesoscopic Systems and Quantum Hall Effectfluorescence microscopyCondensed Matter::Materials Scienceexciton diffusionoptiset laitteeteksitonin diffuusiolämpötilaFourier transform infrared (FTIR) spectroscopyliuottimet
researchProduct