Search results for "levetiracetam"

showing 10 items of 34 documents

Apnea events in neonatal age: A case report and literature review.

2019

Abstract Background Among the most common autonomic signs visible in preterm neonates, apnea can represent the first sign of several neurologic and non-neurologic disorders, and seizure is a relatively infrequent cause. Herein authors present a case of neonatal autonomic apnea, discussing the polygraphic video-EEG features of this pathological entity and the differential diagnosis with central apnea and autonomic apnea. Case report A female preterm Caucasian infant (29 + 4 weeks' gestational age (GA)), first twin of a twin pregnancy, at birth was intubated and surfactant administration was performed. She was ventilated via invasive ventilation for three days, with subsequent weaning with no…

0301 basic medicineLevetiracetamCentral apneaVideo RecordingDiseasesInfant Premature Diseases0302 clinical medicinenewbornDiagnosisHypoxiaApneaSleep apneaGestational ageElectroencephalographyGeneral MedicineSleep Apnea CentralAnesthesiaNervous System Diseases; Bradycardia; Cyanosis; Diagnosis Differential; Humans; Hypoxia; Infant Newborn; Infant Premature; Infant Premature Diseases; ; Sleep ApneaBreathingAnticonvulsantsFemalemedicine.symptomInfant PrematureBradycardiaSleep ApneaContext (language use)Gestational AgeNODiagnosis Differential03 medical and health sciencesSeizuresHeart ratemedicineBradycardiaDiseases in TwinsHumansPrematureCyanosisbusiness.industryInfant NewbornInfantapneamedicine.disease030104 developmental biologyAutonomic Nervous System DiseasesDifferentialNervous System Diseasesbusinesspreterm030217 neurology & neurosurgeryneurologic disorders
researchProduct

Repurposing of the Antiepileptic Drug Levetiracetam to Restrain Neuroendocrine Prostate Cancer and Inhibit Mast Cell Support to Adenocarcinoma

2021

A relevant fraction of castration-resistant prostate cancers (CRPC) evolve into fatal neuroendocrine (NEPC) tumors in resistance to androgen deprivation and/or inhibitors of androgen receptor pathway. Therefore, effective drugs against both CRPC and NEPC are needed. We have previously described a dual role of mast cells (MCs) in prostate cancer, being capable to promote adenocarcinoma but also to restrain NEPC. This finding suggests that a molecule targeting both MCs and NEPC cells could be effective against prostate cancer. Using an in silico drug repurposing approach, here we identify the antiepileptic drug levetiracetam as a potential candidate for this purpose. We found that the protein…

0301 basic medicineMaleLevetiracetammast cellsneuroendocrine differentiationNeuroendocrine differentiationCell DegranulationAndrogen deprivation therapyProstate cancer0302 clinical medicineTumor Cells CulturedImmunology and AllergySV2AOriginal ResearchMembrane Glycoproteinsdrug repurposingCell Differentiationprostate cancerGene Expression Regulation NeoplasticMatrix Metalloproteinase 9030220 oncology & carcinogenesisAdenocarcinomaAnticonvulsantsLevetiracetammedicine.druglcsh:Immunologic diseases. AllergyImmunologyAntineoplastic AgentsMice TransgenicNerve Tissue Proteins03 medical and health sciencesmedicineAnimalsHumanstumor microenvironmentmouse modelsHigh-grade prostatic intraepithelial neoplasiadrug repurposing; mast cells; mouse models; neuroendocrine differentiation; prostate cancer; tumor microenvironmentCell Proliferationbusiness.industryDrug RepositioningProstatic NeoplasmsNeoplasms Experimentalmedicine.diseaseCarcinoma Neuroendocrinedrug repurposing mast cells mouse models neuroendocrine differentiation prostate cancer tumor microenvironmentAndrogen receptorMice Inbred C57BL030104 developmental biologyCancer researchlcsh:RC581-607business
researchProduct

2019

Epileptic activity without visible convulsions is common in Alzheimer's disease (AD) and may contribute adversely to the disease progress and symptoms. Transgenic mice with amyloid plaque pathology also display epileptic seizures, but those are too infrequent to assess the effect of anti-epileptic treatments. Besides spontaneous seizures, these mice also display frequent epileptic spiking in epidural EEG recordings, and these have provided a means to test potential drug treatment to AD-related epilepsy. However, the origin of EEG spikes in transgenic AD model mice has remained elusive, which makes it difficult to relate electrophysiology with underlying pathology at the cellular and molecul…

0301 basic medicinemedicine.diagnostic_testbusiness.industryHippocampusHippocampal formationElectroencephalographymedicine.diseaseCortex (botany)03 medical and health sciencesEpilepsyElectrophysiology030104 developmental biology0302 clinical medicineEthosuximideNeurologymental disordersmedicineNeurology (clinical)LevetiracetambusinessNeuroscience030217 neurology & neurosurgerymedicine.drugFrontiers in Neurology
researchProduct

Reduced firing rates of pyramidal cells in frontal cortex of APP/PS1 can be restored by acute treatment with levetiracetam

2019

AbstractIn recent years aberrant neural oscillations in various cortical areas have emerged as a common physiological hallmark across mouse models of amyloid pathology and patients with Alzheimer’s disease. However, much less is known about the underlying effect of amyloid pathology on single cell activity. Here, we used high density silicon probe recordings from frontal cortex area of 9 months old APP/PS1 mice to show that resting state Local Field Potential (LFP) power in the theta and beta band is increased in transgenic animals, while single cell firing rates, specifically of putative pyramidal cells, are significantly reduced. At the same time, these sparsely firing pyramidal cells pha…

0303 health sciencesFrontal cortexResting state fMRITransgeneCellLocal field potentialBiology03 medical and health sciencesBeta band0302 clinical medicinemedicine.anatomical_structuremedicineBeta RhythmLevetiracetamNeuroscience030217 neurology & neurosurgery030304 developmental biologymedicine.drug
researchProduct

The sustainable synthesis of levetiracetam by an enzymatic dynamic kinetic resolution and an ex-cell anodic oxidation

2021

Levetiracetam is an active pharmaceutical ingredient widely used to treat epilepsy. We describe a new synthesis of levetiracetam by a dynamic kinetic resolution and a ruthenium-catalysed ex-cell anodic oxidation. For the enzymatic resolution, we tailored a high throughput screening method to identify Comamonas testosteroni nitrile hydratase variants with high (S)-selectivity and activity. Racemic nitrile was applied in a fed-batch reaction and was hydrated to (S)-(pyrrolidine-1-yl)butaneamide. For the subsequent oxidation to levetiracetam, we developed a ligand-free ruthenium-catalysed method at a low catalyst loading. The oxidant was electrochemically generated in 86% yield. This route pro…

Active ingredientbiologyNitrile010405 organic chemistry010402 general chemistrybiology.organism_classification01 natural sciencesPollutionCombinatorial chemistry0104 chemical sciencesKinetic resolutionCatalysischemistry.chemical_compoundchemistryNitrile hydrataseYield (chemistry)medicineEnvironmental ChemistryComamonas testosteroniLevetiracetammedicine.drugGreen Chemistry
researchProduct

Correction to: Adjunctive Brivaracetam in Focal Epilepsy: Real‑World Evidence from the BRIVAracetam add‑on First Italian netwoRk Study (BRIVAFIRST)

2021

In randomized controlled trials, add-on brivaracetam (BRV) reduced seizure frequency in patients with drug-resistant focal epilepsy. Studies performed in a naturalistic setting are a useful complement to characterize the drug profile.This multicentre study assessed the effectiveness and tolerability of adjunctive BRV in a large population of patients with focal epilepsy in the context of real-world clinical practice.The BRIVAFIRST (BRIVAracetam add-on First Italian netwoRk STudy) was a retrospective, multicentre study including adult patients prescribed adjunctive BRV. Patients with focal epilepsy and 12-month follow-up were considered. Main outcomes included the rates of seizure-freedom, s…

AdultMaleDrug Resistant EpilepsyLevetiracetamEpilepsy CNS therapyCorrectionMiddle AgedSettore MED/26PyrrolidinonesPsychiatry and Mental healthTreatment OutcomeItalyChemotherapy AdjuvantHumansPharmacology (medical)AnticonvulsantsFemaleNeurology (clinical)Epilepsies PartialRetrospective Studies
researchProduct

Levetiracetam in the prophylaxis of migraine with aura: a 6-month open-label study.

2006

OBJECTIVE: To evaluate the efficacy of levetiracetam as prophylactic treatment for migraine with aura with high frequency of attacks. BACKGROUND: Migraine with aura with high frequency of attacks could represent a very demanding therapeutic problem. Efficacy of the antiepileptic drug, lamotrigine, has been reported in this form of migraine. Levetiracetam is a new antiepileptic drug with an excellent tolerability profile. Mechanisms of action of this drug remain largely unknown, but recently, it has been shown to exert inhibitory effects on neuronal-type calcium channels. METHODS: We performed a small open-label trial treating 16 patients affected by migraine with aura with high frequency of…

AdultMaleLevetiracetamAuraMigraine with AuraLamotrigineMedicineHumansPharmacology (medical)Prospective StudiesProspective cohort studyPharmacologybusiness.industryMiddle Agedmedicine.diseasePiracetamMigraine with auraTolerabilityMigraineAnesthesiaAnticonvulsantsFemaleNeurology (clinical)Levetiracetammedicine.symptombusinessSomnolencemedicine.drugClinical neuropharmacology
researchProduct

Abnormal facilitatory mechanisms in motor cortex of migraine with aura

2010

Experimental evidence suggests impairment of inhibitory intracortical circuits in migraine, while not much is known about activity of facilitatory intracortical circuits. In the present work we evaluated the effects of high frequency-repetitive transcranial magnetic stimulation (hf-rTMS) on the activity of facilitatory circuits of motor cortex in 18 patients affected by migraine with aura and 18 healthy subjects. Trains of 10 stimuli were applied to the motor cortex at 5-Hz frequency with recording of the EMG traces from the contralateral abductor pollicis brevis muscle (APB). Two intensities of stimulation (110% and 130% of resting motor threshold) were used in order to explore whether mot…

AdultMaleLevetiracetammedicine.medical_treatmentMigraine with AuraStimulationInhibitory postsynaptic potentialHomeostatic plasticitymedicineHumansNeuronsAbductor pollicis brevis muscleElectromyographyMotor CortexEvoked Potentials Motormedicine.diseasePiracetamTranscranial Magnetic StimulationMigraine with auraTranscranial magnetic stimulationAnesthesiology and Pain Medicinemedicine.anatomical_structureMigraineAbnormal facilitatory mechanisms motor cortex migraine with aura.FemaleNerve Netmedicine.symptomPsychologyNeuroscienceMotor cortexEuropean Journal of Pain
researchProduct

Levetiracetam during 1-year follow-up in children, adolescents, and young adults with refractory epilepsy

2004

Purpose: To evaluate the efficacy and safety of levetiracetam (LEV) in refractory crypto/symptomatic, partial or generalised epilepsy in children, adolescents and young adults. Methods: We performed a prospective open label add-on study in 99 patients (age 12 months to 32 years, mean 14 years) with partial or generalised, crypto/symtpomatic seizures. Levetiracetam was added to no more than two baseline AEDs and the efficacy was rated according to seizure type and frequency. Results: LEV was initiated at the starting dose of 10 mg/kg/day with 5-day increments up to 50 mg/kg/day, unless it was not tolerated. Concomitant therapy was generally not modified throughout the study. After a mean fol…

AdultMalePediatricsmedicine.medical_specialtyAdolescentmedicine.medical_treatmentlevetiracetamefficacyIrritabilityStatistics NonparametricEpilepsyDOUBLE-BLINDantiepileptic drugmedicineHumansprospective trialProspective StudiesChildAdverse effectChi-Square DistributionEpilepsybusiness.industryInfantmedicine.diseasePiracetamAnticonvulsantNeurologyTolerabilityEpilepsy in childrenChild PreschoolAnesthesiaEpilepsy syndromesFemaleTRIALNeurology (clinical)Levetiracetammedicine.symptomtolerability PARTIAL SEIZURESbusinessFollow-Up Studiesmedicine.drug
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct