Search results for "luu"

showing 10 items of 614 documents

Bone mineral density of the proximal femur after hip resurfacing arthroplasty: 1-year follow-up study

2011

Abstract Background Hip resurfacing arthroplasty (HRA) is considered a bone-preserving procedure and may eliminate proximal femoral stress shielding and osteolysis. However, in addition to implant-related stress-shielding factors, various patient-related factors may also have an effect on bone mineral density (BMD) of the proximal femur in patients with HRA. Thus, we studied the effects of stem-neck angle, demographic variables, and physical functioning on the BMD of the proximal femur in a one-year follow-up. Methods Thirty three patients (9 females and 24 males) with a mean (SD) age of 55 (9) years were included in the study. BMD was measured two days and 3, 6, and 12 months postoperative…

musculoskeletal diseasessurgeryluuntiheysbone mineral densitylonkan pinnoiteleikkaus
researchProduct

Propagandasta ja vihasta : kuinka annetut kuvat alistavat ihmisen rituaalisen kielen käyttäjäksi

2012

Tutkimuksen tehtävänä on selvittää, kuinka viha ja propaganda liittyvät toisiinsa ja mitä epäpyhästä liittoumasta seuraa. Motivoivana kysymyksenä tutkimuksen taustalla on: miksi ihminen on toiselle ihmiselle niin kelju, että olemme joutuneet ikuiseen sotatilaan suhteessa Toisiin niin mielissämme, kuin rintamallakin? Tutkimus tarkastelee, mitä propaganda nykypäivänä tarkoittaa, ketkä sitä levittävät, miksi, ja miten se vaikuttaa ihmiseen. Tutkimuksessa vihaa tarkastellaan massoihin kohdistuvana moraalisena ilmiönä ja suhteessa propagandaan. Käsittelyn ulkopuolelle jäävät propagandan tuottamiseen kykenemättömät heikot instituutiot ja niiden vastarintaan liittyvä kapinallinen viha. Tutkimuksen…

myytityleinen mielipidejulkinen mielipidepropagandaPRennakkoluulodehumanisaatiosuhdetoimintaennakkoluulotdemokratiametaforavihapuhevihamyytti
researchProduct

The impact of Nordic walking on bone properties in postmenopausal women with pre-diabetes and non-alcohol fatty liver disease

2021

This study investigated the impact of Nordic walking on bone properties in postmenopausal women with pre-diabetes and non-alcohol fatty liver disease (NAFLD). A total of 63 eligible women randomly participated in the Nordic walking training (AEx, n = 33), or maintained their daily lifestyle (Con, n = 30) during intervention. Bone mineral content (BMC) and density (BMD) of whole body (WB), total femur (TF), femoral neck (FN), and lumbar spine (L2-4) were assessed by dual-energy X-ray absorptiometry. Serum osteocalcin, pentosidine, receptor activator of nuclear factor kappa-B ligand (RANKL) levels were analyzed by ELISA assay. After an 8.6-month intervention, the AEx group maintained their BM…

naisetHealth Toxicology and MutagenesisEndocrinology Diabetes and Metabolismpostmenopausal womenbiomarkkeritAlcoholDiseases of the musculoskeletal systemWalkingDiseasesauvakävelychemistry.chemical_compound0302 clinical medicineAbsorptiometry PhotonBone DensityNon-alcoholic Fatty Liver DiseaseOrthopedics and Sports Medicine030212 general & internal medicineNordic walkingOsteoporosis PostmenopausalbiologykuntoliikuntaFemur Neckmusculoskeletal neural and ocular physiologyFatty liverRmusculoskeletal systemPostmenopausemedicine.anatomical_structureRANKLPre diabetesOsteocalcinMedicineFemaleikääntyneetmusculoskeletal diseasesmedicine.medical_specialtyluuntiheys030209 endocrinology & metabolismArticlePrediabetic State03 medical and health sciencesbone markersInternal medicinemedicineHumansFemurPentosidineFemoral neckPostmenopausal womenbusiness.industryPublic Health Environmental and Occupational Healthmedicine.diseaseEndocrinologyRC925-935chemistryei-alkoholiperäinen rasvamaksasairausbiology.proteinfatty liver diseasebone mineral densitybusinessaikuistyypin diabetesBone Reports
researchProduct

Adolescent Sport Participation and Age at Menarche in Relation to Midlife Body Composition, Bone Mineral Density, Fitness, and Physical Activity

2020

This study aimed to investigate the associations of competitive sport participation in adolescence and age at menarche (AAM) with body composition, femoral neck bone mineral density (BMD), physical performance, and physical activity (PA) in middle-aged women. 1098 women aged 47&ndash

naisetTíðir kvennakeski-ikäluuntiheyslcsh:Medicinephysical activityLíkamsástandkuukautisetAdolescent athletesBody compositionArticleÍþróttafólkPhysical performanceage at menarcheFemale athletesparasitic diseasesBone mineral densityHreyfing (heilsurækt)UnglingarBeinþéttnifemale athleteKonurkehonkoostumussuorituskykyAge at menarchebody compositionPhysical activitylcsh:RKynþroskiphysical performancemurrosikänuoruusadolescent athletebone mineral densityfyysinen aktiivisuusurheilijat
researchProduct

Muscle cross-sectional area and structural bone strength share genetic and environmental effects in older women

2009

The purpose of this study was to estimate to what extent muscle cross-sectional area of the lower leg (mCSA) and tibial structural strength are influenced by common and trait-specific genetic and environmental factors. pQCT scans were obtained from both members of 102 monozygotic (MZ) and 113 dizygotic (DZ) 63- to 76-yr-old female twin pairs to estimate the mCSA of the lower leg, structural bending strength of the tibial shaft (BSIbend), and compressive strength of the distal tibia (BSIcomp). Quantitative genetic models were used to decompose the phenotypic variances into common and trait-specific additive genetic (A), shared environmental (C), and individual environmental (E) effects. The …

naisetikääntyminenympäristötekijätagingLihaksen poikkipinta-alaluun vahvuusbone strengthgeneettiset tekijätmuscle cross-sectional area
researchProduct

Bringing madness home : the multiple meanings of home in Janet Frame's Faces in the water, Bessie Head's A question of power and Lauren Slater's Proz…

2012

naisetkirjallisuusomaelämäkerrallisuusliteraturekotiaiheethomespacepsychiatrymielenterveyspsykiatrinen hoitomielenterveyshäiriötgenderhulluuswomen's madnessbelongingFeministinen kirjallisuudentutkimus
researchProduct

Koti ja hulluus, koditon hulluus

2014

naisetkodittomuuspsyykkisesti sairaatasunnottomuusavohoitomielenterveyshäiriötkotihulluusmielenterveyskuntoutujatmielenterveysongelmattyökyvyttömyys
researchProduct

DIFFERENTIAL INFLUENCE OF PERIPHERAL AND SYSTEMIC SEX STEROIDS ON SKELETAL MUSCLE QUALITY IN PRE- AND POSTMENOPAUSAL WOMEN.

2011

Aging is associated with gradual decline of skeletal muscle strength and mass often leading to diminished muscle quality. This phenomenon is known as sarcopenia and affects about 30% of the over 60-year-old population. Androgens act as anabolic agents regulating muscle mass and improving muscle performance. The role of female sex steroids as well as the ability of skeletal muscle tissue to locally produce sex steroids has been less extensively studied. We show that despite the extensive systemic deficit of sex steroid hormones in postmenopausal compared to premenopausal women, the hormone content of skeletal muscle does not follow the same trend. In contrast to the systemic levels, muscle t…

naisetpaikallinen ja systeeminen steroidogeneesiluustolihasvaihdevuodetskeletal musclelocal and systemic steroidogenesisikä
researchProduct

"Rämpylät työelämässä" : tutkielma MS-tautia sairastavien naisten kokemuksista

2006

naisettyökyvyttömyyseläkkeetMS-tautisyrjintävammaisetosa-aikaeläkkeetinkluusiovajaakuntoiset
researchProduct

Sisters of the Brotherhood: Alienation and Inclusion in Learning Philosophy

2023

This open access book explores the gendered reality of learning philosophy at the university level, investigating the ways in which women and minority students become alienated from the social practices of a male-dominated field, and examining pedagogical solutions to this problem. It covers the roles and the interactions of the professor and student in the following ways: (1) the historical situation, (2) the affective, social and bodily situation, and (3) the moral situation. This text analyzes women’s passion for philosophy as a quest for truth, as well as their partial alienation from the social practices of philosophy. It demonstrates that recognition, generosity, and care are central …

naisetwomen studentspassion for philosophyphilosophy and educationinclusion in philosophyteaching philosophyvähemmistötminorities in philosophyphilosophical canonsituatedness of learningsocrates tenuredunderrepresentation of womenvieraantuminenfilosofiainclusive learningrenewal of philosophywomen in philosophyfeministinen filosofiaalienation from philosophykorkeakoulupedagogiikkainkluusio
researchProduct