Search results for "neutronit"

showing 5 items of 25 documents

Probing the shape of 176Hg along the yrast line

1998

In-beam γ-ray and γ-γ coincidence measurements have been made for the very neutron-deficient nucleus 176Hg using the recoil-decay tagging (RDT) technique. The irregular yrast sequence observed up to I=10ħ indicates that the prolate intruder band, seen in heavier Hg isotopes near the neutron midshell, crosses the nearly spherical ground-state band of 176Hg above I=6ħ. peerReviewed

isotoopitNuclear TheoryneutronitfysiikkaNuclear Experimentydinfysiikka
researchProduct

First β-decay spectroscopy of $^{135}$In and new $β$-decay branches of $^{134}$In

2021

International audience; The $\beta$ decay of the neutron-rich $^{134}$In and $^{135}$In was investigated experimentally in order to provide new insights into the nuclear structure of the tin isotopes with magic proton number $Z=50$ above the $N=82$ shell. The $\beta$-delayed $\gamma$-ray spectroscopy measurement was performed at the ISOLDE facility at CERN, where indium isotopes were selectively laser-ionized and on-line mass separated. Three $\beta$-decay branches of $^{134}$In were established, two of which were observed for the first time. Population of neutron-unbound states decaying via $\gamma$ rays was identified in the two daughter nuclei of $^{134}$In, $^{134}$Sn and $^{133}$Sn, at…

isotoopitmittausAstrophysics::High Energy Astrophysical PhenomenaspektroskopiaNuclear TheoryNuclear Physics - Experimentneutronit[PHYS.NEXP]Physics [physics]/Nuclear Experiment [nucl-ex]fysiikkaydinfysiikkaNuclear ExperimentNuclear Experiment
researchProduct

Radio signatures from encounters between neutron stars and QCD-axion minihalos around primordial black holes

2021

Probing the QCD axion dark matter (DM) hypothesis is extremely challenging as the axion interacts very weakly with Standard Model particles. We propose a new avenue to test the QCD axion DM via transient radio signatures coming from encounters between neutron stars (NSs) and axion minihalos around primordial black holes (PBHs). We consider a general QCD axion scenario in which the PQ symmetry breaking occurs before (or during) inflation coexisting with a small fraction of DM in the form of PBHs. The PBHs will unavoidably acquire around them axion minihalos with the typical length scale of parsecs. The axion density in the minihalos may be much higher than the local DM density, and the prese…

pimeä aineHigh Energy Physics::TheoryneutronitähdetPhysics::Instrumentation and DetectorsAstrophysics::High Energy Astrophysical PhenomenaHigh Energy Physics::Phenomenologymustat aukotAstrophysics::Cosmology and Extragalactic Astrophysicskosmologiaradioaallot
researchProduct

DM-like anomalies in neutron multiplicity spectra

2021

Abstract A new experiment collects data, since November 2019, at a depth of 210 m.w.e. in the Callio Lab in the Pyhasalmi mine in Finland. The setup, called NEMESIS (New Emma MEasurementS Including neutronS), incorporates infrastructure from the EMMA experiment with neutron and large-area plastic scintillator detectors. The experiment’s primary aim is to combine muon tracking with position-sensitive neutron detection to measure precision yields, multiplicities, and lateral distributions of high-multiplicity neutron events induced by cosmic muons in various materials. The data are relevant for background evaluation of the deep-underground searches for Dark Matter (DM), neutrino-less double b…

pimeä aineHistoryPhysics::Instrumentation and Detectorsilmaisimetneutronithiukkasfysiikka114 Physical sciencesComputer Science ApplicationsEducation
researchProduct

Gauge theory phase diagrams from holography

2014

säieteoriaduaaliteoriaydinreaktiotneutronitähdetraskasionitörmäyksetkvarkittiheysfaasidiagrammilämpötilafaasitGauge/gravity dualitiesydinainehiukkasfysikka
researchProduct