Search results for "patologia"

showing 10 items of 930 documents

Surrogati di Presenza

2007

psicotecnologie comunicazione psicopatologia
researchProduct

Mafia e psicoterapia

2012

Il lavoro prende le mosse dal lavoro di Girolamo Lo Verso “La mafia in psicoterapia”, un volume che racchiudere quasi vent’anni di studi sulla psicologia del fenomeno mafioso e consente al lettore di far luce su un ambito poco conosciuto, sia a livello nazionale che internazionale, quale quello relativo alla relazione terapeutica con pazienti appartenenti a famiglie mafiose, e di comprendere le gravi ricadute psichiche che la mafia provoca sia nei suoi appartenenti, sia in coloro che, a vario titolo, entrano in contatto con essa (cittadini, vittime, comunità…). Di particolare rilievo, oltre alla presentazione delle ricerche portate avanti negli anni, risulta essere l’esposizione di numerosi…

psychotherapylcsh:Ethnology. Social and cultural anthropologyMafia psychotherapy psychopathologylcsh:GN301-674lcsh:P101-410mafiapsychopathologyMafia psicoterapia psicopatologialcsh:Language. Linguistic theory. Comparative grammarNarrare i Gruppi
researchProduct

Mitä filosofi tekee psykiatrisella klinikalla, Thomas Fuchs?

2019

Saksassa Heidelbergin yliopistoklinikalla on pitkät perinteet filosofian ja psykiatrian yhteistyölle. Fenomenologisen psykiatrian ja psykoterapian tutkimusyksikköä johtava professori Thomas Fuchs kertoo, miten fenomenologista tutkimusta tehdään psykiatrisessa sairaalassa ja kuinka hänen omat filosofiset sitoumuksensa tulevat esille potilastyössä. Keskustelumme klinikalla valotti hänen ajattelunsa pääpiirteitä kehollisuudesta, tunteiden filosofiasta ja tiedostamattomasta. Fuchs käsittää tunteet vuorovaikutteisina, ruumiillisina ja tilallisina ilmiöinä ja väittää, ettei tiedostamaton sijaitse psyyken syvyyksissä vaan on kehollisesti eletty ja koettu. nonPeerReviewed

psykiatriamielenterveyshäiriöthaastattelutfenomenologiaFuchs Thomaspsykoterapiaruumiillisuuspsykopatologiatiedostamaton
researchProduct

RED BLOOD CELL DISTRIBUTION WIDTH PREDICTS MORBIDITY AND MORTALITY AFTER AORTIC VALVE REPLACEMENT

2014

Objective: Red blood cell distribution width (RDW), is a measurement of the size variation as well as an erythrocyte heterogeneity index (i.e., anysocytosis). used in combination with the mean corpuscular volume for anemia diagnosis. However, it is emerging as an useful predictor biomarker of mortality and morbidity of cardiovascular diseases. However, until now no literature data there are about the RDW role in predicting mortality after aortic valve replacement (AVR). Thus, in this pilot study biological significance of elevated RDW values in early outcome following AVR was evaluated Methods: We enrolled 75 patients (mean age 73.5 ±7.9 years) subjected to AVR and/ or not co temporally to …

red distribution width aortic valve replacement mortality and morbiditySettore MED/05 - Patologia ClinicaSettore MED/23 - Chirurgia Cardiaca
researchProduct

Detection of Southern tomato virus by molecular hybridisation

2017

Southern tomato virus (STV) is a double-stranded RNA (dsRNA) virus belonging to the genus Amalgavirus from the family Amalgamaviridae. STV has been detected in tomato plants showing symptoms of stunting, fruit discoloration and size reduction, although its role on symptom development is unclear. Also, little is known about the incidence and epidemiology of this virus and how it spreads in tomato crops. In this work, we developed a molecular hybridisation method by using a digoxigenin-labelled RNA probe based on the nucleotide sequence of the STV putative coat protein which was tested with different procedures for preparation of plant material. This technique was sensitive enough to detect S…

riboprobeAmalgaviruSTVSettore AGR/12 - Patologia VegetaleAmalgaviridae
researchProduct

Phenomenological Strands for Gaming Disorder and Esports Play: A Qualitative Registered Report

2021

The recent inclusion of gaming disorder in the ICD-11 as a mental disorder has further increased the importance of researching the health spectrum related to gaming. A critical area in this regard is the lack of clarity concerning the differences between gaming disorder and intensive play, the latter of which often involves several gaming hours per day without related health problems. In this study, we approached the above question by interpretive phenomenological analysis with interviews in two groups of highly involved videogame players: those who seek or have sought clinical help for their problems with gaming (n=6), and those who play esports more than 4 hours per day without self-repor…

riippuvuusvideopelitfenomenologiaongelmapelaaminenterveysaddiktiivisuuspsykopatologia
researchProduct

Evaluation of oleander accessions for resistance to Pseudomonas savastanoi pv. nerii

2006

Nine oleander accessions were evaluated for resistance to Pseudomonas savastanoi pv. nerii, causal agent of the oleander knot disease. None of the accessions was resistant when tested with three bacterial strains of different virulence, but they varied significantly in the severity of symptoms induced by these strains. The most susceptible accessions "Dark Salmon" (dark salmon flower) showed deformation of stems, leaves and seed pods and secondary knots on aerial parts, whereas the least susceptible one "White" (white flower), inoculated with the least virulent strain, showed neither localized knots at the inoculation point nor secondary symptoms. In this study an in vitro test, based on pr…

screening for resistancedetached leaf assaySettore AGR/12 - Patologia VegetalePlant ScienceNerium oleander; Oleander knot disease; screening for resistance; detached leaf assayNerium oleanderOleander knot disease
researchProduct

The Necrophilic Laughter : Humor as a Social Pathology

2018

In this article, I claim that humor can be a form of social pathology. In opposition to the general humor-affirmative atmosphere, I develop the critical tradition of humor research, and suggest that there is a darker side to fun and laughter. Using insights from Henri Bergson’s theory about laughter and Erich Fromm’s critical social thinking, I formulate a novel theoretical combination which opens up fruitful perspectives on contemporary humor and its social nature. This empirically motivated conceptual position helps us to understand the role and function of humor and laughter. My conclusion is that parts of the contemporary humor catalogue reflect collective destructive and even death-ori…

sosiaalinen patologiasosiaalipatologiahumornauruhuumori
researchProduct

Who Is Ill When a Society Is Ill?

2021

This chapter gives an overview of four different approaches to social pathologies, which are present in contemporary critical social theory, and analyses their social-ontological commitments. The different approaches can be divided into two camps. The ‘thin sense’ of social pathology focuses on social wrongs, and the socially caused and pervasive suffering of individuals. The ‘thick sense’ of social pathology, in turn, claims that society is its own entity, or a whole, which can be ill. This chapter discloses the ontological commitments behind different conceptions of social pathology in order to highlight what difference these commitments make in relation to the critical potential of socia…

sosiaalipatologiayhteiskuntafilosofiaontologiat (tiedonhallinta)
researchProduct

Il sostegno multidisciplinare dell'adolescente con patologia reumatologica: progetto pilota della Clinica Pediatrica di Palermo

2014

sostegno multidisciplinareSettore MED/38 - Pediatria Generale E Specialisticaadolescentepatologia reumatologica
researchProduct