Search results for "pelit"

showing 10 items of 484 documents

Siunauksen tilat : pohjalaiset siunauskappelit ja hautaushuoneet

2015

Tämän maisteritutkielman tavoitteena on lisätä tietoa ja ymmärrystä siunauskappelirakennuksista osana kirkollista rakentamista. Tutkielmassa on keskitytty Etelä-Pohjanmaan ja Pohjanmaan nykyisten maakuntien alueiden siunauskappelirakennuksiin, mutta tutkimustulokset antavat lisätietoa yleisellä tasolla siunauskappeleista rakennustyyppinä sekä kirkollisen rakentamisen ilmiönä. Empiirisen tutkimuksen piiriin kuuluva tutkielman aineistoa on analysoitu laadullisin ja määrällisin menetelmin. Tutkimus on toteutettu kokonaistutkimuksena ja tutkimusaineistona on käytetty alueella sijaitsevia tai sijainneita siunauskäytössä olleita rakennusta sekä niiden rakennushistorioita. Aineistossa on huomioitu…

rakennusperintökappelitkirkollinen rakennushautausmaahautaushautausmaatarkkitehtuurirakennussuojeluPohjanmaaSiunauskappeliEtelä-Pohjanmaa
researchProduct

Sega Rally oli oman elämänsä maanteiden kuninkaiden mansikkapaikka

2022

Jos entisaikojen viihdekioskeista yksi pitäisi nostaa ylitse muiden, se olisi vuonna 1994 ilmestynyt Sega Rally Championship, jossa tuijotetaan hypnoottismagneettisesti sumentunutta monitoria ja suhataan pientareita pitkin kartturin tsempatessa. nonPeerReviewed

ralliautoilukolikkopelitajopelit (digitaaliset pelit)pelikulttuurikansallinen kulttuuri
researchProduct

Nörttejä, hikkyjä ja poneista tykkääviä miehiä : fandom-tutkimuksen seminaari pureutui nörttikulttuuriin

2016

raportitnörttikulttuuripelitfanitutkimusscience fictionfandomvastakulttuuricosplaysarjakuvat
researchProduct

Exploring early adolescents’ stressful IT use experiences

2022

Early adolescents are accustomed to using information technology (IT) for different purposes as a part of their everyday life. While IT use can provide many benefits, it can also include negative experiences, such as feelings of stress (i.e. technostress). Considering that young IT users’ technostress perspectives have remained limited in the literature, this paper attempts to contrast their experiences with aspects from earlier research. A qualitative content analysis of semi-structured interviews with 31 primary and secondary school students reveals that early adolescents have encountered stressful IT use experiences that vary based on the degree of stress. The experiences relate to diffe…

rasitusIT usevaikutuksetsosiaalinen mediaGeneral Social Sciences512 Business and managementvarhaisnuorettietotekniikkaearly adolescentsuupumusHuman-Computer InteractionmobiililaitteetArts and Humanities (miscellaneous)tunteetverkko-opiskelustressful experiencesDevelopmental and Educational Psychologystressinhallintaverkkopelittechnostressteknostressi
researchProduct

Balancing food, activity and the dangers of sunlit nights

2019

Living in northern latitudes poses challenges to the animals that live in those habitats. The harsh environment provides a short breeding season where the sunlit summer nights provide little reprieve from visibility to predators and increased risk. In this paper, we tested the activity and food choice patterns of bank voles Myodes glareolus in early spring season, categorized by 18 h of daylight and 6 h of dusk in every day cycle. We found that territorial females showed a less predictable pattern of activity than males that were most active during the hours of dusk. The voles also showed preference to forage on high carbohydrate foods at sunset, while switching over to a more protein and f…

ravintophysiological energeticssex bias and social behaviourevoluutioekologiametsämyyrävole-weasel model systempeliteoriaforaging ecologyevolutionary game theorysubarctic forestseläinten käyttäytyminensaalistus
researchProduct

The foundations of Let’s Play : Live action representation of video games in television and online 1975-2018

2019

In this article, I look at television shows based on video games in comparison to modern Let’s Play –videos. The paper draws a timeline from the earliest shows to modern days and discusses the evolution of video games representation throughout the years. For the study, I gathered a global dataset of old television programs about the subject and categorized the findings. When comparing the narrative and representation of the television shows with Let’s Plays, the study suggests that even though there are some similar elements between the two, they are still cultural products of their own. As Let’s Plays are more narrative products than the television shows, they are a phenomenon of their own…

representaationarratiivisuusLet’s PlayvideopelitComputingMilieux_PERSONALCOMPUTINGtelevisio-ohjelmattelevisionComputingMilieux_MISCELLANEOUSpelitutkimus
researchProduct

Pokeridiivat ja ruutukunkut : pokeriammattilaisuus ja sukupuoli suomalaisessa mediassa

2010

Rahapelaamista on pitkään pidetty paheellisena ja riippuvuutta aiheuttavana toimintana, jonka on mielletty kuuluvan nimenomaan miehille. Nykyisin pelaaminen on kuitenkin harrastus yhä useammalle, ja naispelaajiakin on aiempaa enemmän. Rahapelaamisen hyväksyttävyyden ja suosion kasvu on käynyt käsi kädessä rajoitusten purkamisen, pelien saatavuuden sekä teknologioiden kehittymisen kanssa. Työelämän arvojen muuttuminen ja työn viihteellistyminen ovat puolestaan luoneet mahdollisuuden uudenlaiselle ammattilaisuudelle. Muutaman viime vuoden ajan media on omalta osaltaan vaikuttanut pelaamisen suosion kasvuun ja esittänyt pokeriammattilaisuuden vaihtoehtona perinteiselle palkkatyölle. Ajatus pok…

representaatiopelaaminenammattilaisetmediarahapelitfeministinen tutkimuspokerityöntutkimusKvalitatiivinen tutkimussukupuoliuhkapelitmediatutkimus
researchProduct

An Ethical Perspective on Loot Box Purchasing : Examining Psychosocial Antecedents and the Association with Indebtedness

2023

Loot boxes are popular random reward mechanisms in digital games, attracting players to invest real money to enhance their gaming experiences. Loot boxes share striking similarities to gambling and might contribute to one’s economic strain, but more research is needed on the underlying vulnerabilities and motivational traits in loot box purchasing. This paper examines associations with self-reported increase in loot box purchasing and debt problems during the first year of the COVID-19 pandemic. International survey data were collected in 2021, consisting of Finnish, Swedish, and British respondents (N = 2,991) aged 18 to 75. Partial least squares modeling was used as an analytical techniqu…

resilienssiostokäyttäytyminenpsykososiaaliset tekijätkuluttajakäyttäytyminenongelmapelaaminensocial relationshipsindebtednesssosiaaliset suhteetyksinäisyyspelaajatlonelinessloot boxresilienceverkkopelit
researchProduct

Phenomenological Strands for Gaming Disorder and Esports Play: A Qualitative Registered Report

2021

The recent inclusion of gaming disorder in the ICD-11 as a mental disorder has further increased the importance of researching the health spectrum related to gaming. A critical area in this regard is the lack of clarity concerning the differences between gaming disorder and intensive play, the latter of which often involves several gaming hours per day without related health problems. In this study, we approached the above question by interpretive phenomenological analysis with interviews in two groups of highly involved videogame players: those who seek or have sought clinical help for their problems with gaming (n=6), and those who play esports more than 4 hours per day without self-repor…

riippuvuusvideopelitfenomenologiaongelmapelaaminenterveysaddiktiivisuuspsykopatologia
researchProduct

Defining Role-Playing Games as Language-Games

2011

Role-playing games are a diverse phenomenon, ranging from digital games to live action role-playing. Finding a definition that suits them all is hard, but attempts have been many. All of the definitions emphasize some aspects of role-playing games like rules, the role of players or the story. Many definitions do not describe role-playing games as such, but the activity that is role-playing. This paper looks at one of the latest attempts to define role-playing games, by Hitchens and Drachen (2009), and shows some potential problems with it. As an answer to these problems another definition is proposed, consisting of a game world, participants, shared narrative power and interaction. This def…

roolipeliComputingMilieux_PERSONALCOMPUTINGrole-playGames--Study and teachingdigitaaliset pelitpelitutkimusInternational Journal of Role-Playing
researchProduct