Search results for "physics.plasm-ph"

showing 10 items of 48 documents

Controlled turbulence regime of electron cyclotron resonance ion source for improved multicharged ion performance

2020

Fundamental studies of excitation and non-linear evolution of kinetic instabilities of strongly nonequlibrium hot plasmas confined in open magnetic traps suggest new opportunities for fine-tuning of conventional electron cyclotron resonance (ECR) ion sources. These devices are widely used for the production of particle beams of high charge state ions. Operating the ion source in controlled turbulence regime allows increasing the absorbed power density and therefore the volumetric plasma energy content in the dense part of the discharge surrounded by the ECR surface, which leads to enhanced beam currents of high charge state ions. We report experiments at the ECR ion source at the JYFL accel…

010302 applied physicsAccelerator Physics (physics.acc-ph)Materials scienceAcoustics and UltrasonicsIon beamFOS: Physical sciencesPlasmaCondensed Matter PhysicsKinetic energy7. Clean energy01 natural sciencesElectron cyclotron resonanceIon sourcePhysics - Plasma Physics010305 fluids & plasmasSurfaces Coatings and FilmsElectronic Optical and Magnetic MaterialsIonPlasma Physics (physics.plasm-ph)Physics::Plasma Physics0103 physical sciencesPhysics - Accelerator PhysicsAtomic physicsExcitationBeam (structure)
researchProduct

Photoelectron Emission from Metal Surfaces Induced by VUV-emission of Filament Driven Hydrogen Arc Discharge Plasma

2015

Photoelectron emission measurements have been performed using a filament-driven multi-cusp arc discharge volume production H^- ion source (LIISA). It has been found that photoelectron currents obtained with Al, Cu, Mo, Ta and stainless steel (SAE 304) are on the same order of magnitude. The photoelectron currents depend linearly on the discharge power. It is shown experimentally that photoelectron emission is significant only in the short wavelength range of hydrogen spectrum due to the energy dependence of the quantum efficiency. It is estimated from the measured data that the maximum photoelectron flux from plasma chamber walls is on the order of 1 A per kW of discharge power.

010302 applied physicsMaterials scienceHydrogenPhysics::Instrumentation and DetectorsFluxchemistry.chemical_elementFOS: Physical sciencesPlasma01 natural sciences7. Clean energyPhysics - Plasma PhysicsIon source010305 fluids & plasmasElectric arcPlasma Physics (physics.plasm-ph)chemistryPhysics::Plasma Physics0103 physical sciencesPhysics::Atomic and Molecular ClustersQuantum efficiencyPhysics::Atomic PhysicsAtomic physicsHydrogen spectral seriesOrder of magnitude
researchProduct

Photoelectron Emission from Metal Surfaces Induced by Radiation Emitted by a 14 GHz Electron Cyclotron Resonance Ion Source

2015

Photoelectron emission measurements have been performed using a room-temperature 14 GHz ECR ion source. It is shown that the photoelectron emission from Al, Cu, and stainless steel (SAE 304) surfaces, which are common plasma chamber materials, is predominantly caused by radiation emitted from plasma with energies between 8 eV and 1 keV. Characteristic X-ray emission and bremsstrahlung from plasma have a negligible contribution to the photoelectron emission. It is estimated from the measured data that the maximum conceivable photoelectron flux from plasma chamber walls is on the order of 10% of the estimated total electron losses from the plasma. peerReviewed

010302 applied physicsMaterials scienceta114Physics::Instrumentation and DetectorsAstrophysics::High Energy Astrophysical PhenomenaCyclotron resonanceBremsstrahlungFOS: Physical sciencesPlasmaElectronphotoelectron emissionRadiation01 natural sciences7. Clean energyElectron cyclotron resonanceIon sourcePhysics - Plasma Physics010305 fluids & plasmasPlasma Physics (physics.plasm-ph)Physics::Plasma Physics0103 physical scienceselectron cyclotron resonance ion sourcesPlasma diagnosticsAtomic physicsInstrumentation
researchProduct

Measurements of the energy distribution of electrons lost from the minimum B-field -- the effect of instabilities and two-frequency heating

2020

Further progress in the development of ECR ion sources (ECRIS) requires deeper understanding of the underlying physics. One of the topics that remains obscure, though being crucial for the performance of the ECRIS, is the electron energy distribution (EED). A well-developed technique of measuring the EED of electrons escaping axially from the magnetically confined plasma of an ECRIS was used for the study of EED in unstable mode of plasma confinement, i.e. in the presence of kinetic instabilities. The experimental data were recorded for pulsed and CW discharges with a room-temperature 14 GHz ECRIS at the JYFL accelerator laboratory. The measurements were focused on observing differences bet…

010302 applied physicsPhysicsResonanceFOS: Physical sciencesPlasmaElectronhiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesPhysics - Plasma PhysicsElectron cyclotron resonanceIon source010305 fluids & plasmasMagnetic fieldIonPlasma Physics (physics.plasm-ph)Magnetic trap0103 physical sciencesAtomic physicsInstrumentation
researchProduct

An Experimental Study of Waveguide Coupled Microwave Heating with Conventional Multicusp Negative Ion Source

2015

Negative ion production with conventional multicusp plasma chambers utilizing 2.45 GHz microwave heating is demonstrated. The experimental results were obtained with the multicusp plasma chambers and extraction systems of the RFdriven RADIS ion source and the filament driven arc discharge ion source LIISA. A waveguide microwave coupling system, which is almost similar to the one used with the SILHI ion source, was used. The results demonstrate that at least one third of negative ion beam obtained with inductive RF-coupling (RADIS) or arc discharge (LIISA) can be achieved with 1 kW of 2.45 GHz microwave power in CW mode without any modification of the plasma chamber. The co-extracted electro…

010302 applied physicsWaveguide (electromagnetism)Materials scienceFOS: Physical sciencesPlasmaElectron7. Clean energy01 natural sciencesIon sourcePhysics - Plasma Physics010305 fluids & plasmasIonPlasma Physics (physics.plasm-ph)Electric arcPhysics::Plasma Physics0103 physical sciencesAtomic physicsMicrowaveBeam (structure)
researchProduct

The modelling of the cathode sheath of an electrical arc in vacuum

2003

This paper presents a simple model of the fragment in the cathode electrical arc root taking into account the physical phenomena occuring on the cathode surface and the sheath. The goal is the obtainment of characteristics values of the heat flux, the electrons, and atoms density in the sheath. Computation is carried out on a one-dimensional model with a coupling between the equation obtained in the sheath and an enthalpy model of the cathode to describe the temperature evolution. In the modelling, we introduce a friction zone above the sheath edge to characterize the heavy particle interactions. Numerical simulation shows that the ionic friction phenomenon deriving from ion–atom collision …

Acoustics and UltrasonicsvacuumIonic bondingarc rootheat fluxElectroncathode sheatharc01 natural sciences010305 fluids & plasmaslaw.inventionElectric arcCross section (physics)lawPhysics::Plasma Physics[PHYS.PHYS.PHYS-PLASM-PH]Physics [physics]/Physics [physics]/Plasma Physics [physics.plasm-ph]0103 physical sciences010306 general physicsCouplingComputer simulationChemistryMechanics[ PHYS.PHYS.PHYS-PLASM-PH ] Physics [physics]/Physics [physics]/Plasma Physics [physics.plasm-ph]Condensed Matter PhysicsCathodeSurfaces Coatings and FilmsElectronic Optical and Magnetic MaterialsHeat flux
researchProduct

Gain lifetime measurement of a Ni-like Ag soft X-ray laser

2012

International audience; Experimental results of a two-stage Ni-like Ag soft X-ray laser operated in a seed-amplifier configuration are presented. Both targets were pumped applying the double-pulse grazing incidence technique with intrinsic travelling wave excitation. The injection of the seed X-ray laser into the amplifier target was realized by a spherical mirror. The results show amplification of the seed X-ray laser and allow for a direct measurement of the gain lifetime. The experimental configuration is suitable for providing valuable input for computational simulations. (C) 2012 Optical Society of America

Amplified spontaneous emissionCODEPhysics::OpticsCurved mirrorBEAM01 natural scienceslaw.inventionCOHERENT010309 opticsLaser linewidthOptics[PHYS.PHYS.PHYS-PLASM-PH]Physics [physics]/Physics [physics]/Plasma Physics [physics.plasm-ph]law0103 physical sciencesSpontaneous emission010306 general physicsPhysics[PHYS.PHYS.PHYS-OPTICS]Physics [physics]/Physics [physics]/Optics [physics.optics]business.industryAmplifierLaserAtomic and Molecular Physics and OpticsTemporal resolutionOptoelectronicsbusinessExcitationOptics Express
researchProduct

Theory of warm ionized gases: Equation of state and kinetic Schottky anomaly

2013

Based on accurate Lennard-Jones type interaction potentials, we derive a closed set of state equations for the description of warm atomic gases in the presence of ionization processes. The specific heat is predicted to exhibit peaks in correspondence to single and multiple ionizations. Such kinetic analogue in atomic gases of the Schottky anomaly in solids is enhanced at intermediate and low atomic densities. The case of adiabatic compression of noble gases is analyzed in detail and the implications on sonoluminescence are discussed. In particular, the predicted plasma electron density in a sonoluminescent bubble turns out to be in good agreement with the value measured in recent experiment…

Condensed Matter::Quantum GasesPhysicsEquation of stateBubbleFOS: Physical sciencesKinetic energy01 natural sciences7. Clean energyHeat capacityPhysics - Plasma Physicssingle-bubble sonoluminescence ; plasma ; cavitationCondensed Matter - Other Condensed MatterPlasma Physics (physics.plasm-ph)SonoluminescenceIonization0103 physical sciencesPhysics::Atomic and Molecular ClustersAtomic physics010306 general physicsAdiabatic process010303 astronomy & astrophysicsSchottky anomalyOther Condensed Matter (cond-mat.other)Physical Review E
researchProduct

Magnetic particle mixing with magnetic micro-convection for microfluidics

2015

International audience; In this paper we discuss the magnetic micro-convection phenomenon as a tool for mixing enhancement in microfluidics systems in cases when one of the mis-cible fluids is a magnetic particle colloid. A system of a water-based magnetic fluid and water is investigated experimentally under homogeneous magnetic field in a Hele-Shaw cell. Subsequent image analysis both qualitatively and quan-titatively reveals the high enhancement of mixing efficiency provided by this method. The mixing efficiency dependence on the magnetic field and the phys-ical limits is discussed. A suitable model for a continuous-flow microfluidics setup for mixing with magnetic micro-convection is als…

ConvectionFerrofluidMaterials scienceMagnetic FluidMicrofluidicsMicrofluidicsNanotechnology02 engineering and technologyMagnetic particle inspectionMagnetic micro-convection01 natural scienceslaw.inventionPhysics::Fluid DynamicsDiffusionMixinglaw[PHYS.PHYS.PHYS-PLASM-PH]Physics [physics]/Physics [physics]/Plasma Physics [physics.plasm-ph]Diffusion (business)Mixing (physics)010401 analytical chemistryMechanicsLab-on-a-chip021001 nanoscience & nanotechnologyCondensed Matter Physics0104 chemical sciencesElectronic Optical and Magnetic MaterialsMagnetic fieldFerrofluid0210 nano-technology
researchProduct

Behavior of gap solitons in anharmonic lattices

2017

International audience; Using the theory of bifurcation, we provide and find gap soliton dynamics in a nonlinear Klein-Gordon model with anharmonic, cubic, and quartic interactions immersed in a parametrized on-site substrate potential. The case of a deformable substrate potential allows theoretical adaptation of the model to various physical situations. Nonconvex interactions in lattice systems lead to a number of interesting phenomena that cannot be produced with linear coupling alone. By investigating the dynamical behavior and bifurcations of solutions of the planar dynamical systems, we derive a variety of exotic solutions corresponding to the phase trajectories under different paramet…

Dynamical systems theory[PHYS.MPHY]Physics [physics]/Mathematical Physics [math-ph]01 natural sciencesFrenkel-Kontorova Model010305 fluids & plasmasPlanar[PHYS.PHYS.PHYS-PLASM-PH]Physics [physics]/Physics [physics]/Plasma Physics [physics.plasm-ph]Quartic functionLattice (order)Dimensional Diatomic Lattice0103 physical sciences[PHYS.MECA.MEFL]Physics [physics]/Mechanics [physics]/Fluid mechanics [physics.class-ph]010306 general physicsBifurcationPhysicsAnharmonicity[ PHYS.MECA.MEFL ] Physics [physics]/Mechanics [physics]/Mechanics of the fluids [physics.class-ph]Systems[ PHYS.PHYS.PHYS-PLASM-PH ] Physics [physics]/Physics [physics]/Plasma Physics [physics.plasm-ph]Nonlinear systemBreathersClassical mechanics[ PHYS.MPHY ] Physics [physics]/Mathematical Physics [math-ph]SolitonDefectAtomic ChainPotentials
researchProduct