Search results for "popular"

showing 10 items of 1042 documents

Lead evaporation instabilities and failure mechanisms of the micro oven at the GTS-LHC ECR ion source at CERN

2020

The GTS-LHC ECR ion source (named after the Grenoble Test Source and the Large Hadron Collider) at CERN provides heavy ion beams for the chain of accelerators from Linac3 up to the LHC for high energy collision experiments and to the Super Proton Synchrotron for fixed target experiments. During the standard operation, the oven technique is used to evaporate lead into the source plasma to produce multiple charged lead ion beams. Intensity and stability are key parameters for the beam, and the operational experience is that some of the source instabilities can be linked to the oven performance. Over long operation periods of several weeks, the evaporation is not stable which makes the tuning …

010302 applied physicsRange (particle radiation)Large Hadron ColliderMaterials scienceionitNuclear engineeringEvaporationPlasmahiukkaskiihdyttimetplasmafysiikka01 natural sciencesSuper Proton SynchrotronIon source010305 fluids & plasmasIonComputer Science::OtherPhysics::Popular Physics0103 physical scienceslyijyInstrumentationBeam (structure)
researchProduct

Introducing the Human Factor in Predictive Modelling: a Work in Progress

2012

International audience; In this paper we present the results of a study into integrating socio-cultural factors into predictive modelling. So far, predictive modelling has largely neglected the social and cultural dimensions of past landscapes. To maintain its value for archaeological research, therefore, it needs new methodologies, concepts and theories. For this study, we have departed from the methodology developed in the 1990s during the Archaeomedes Project. In this project, cross-regional comparisons of settlement location factors were made by analyzing the environmental context of Roman settlements in the French Rhône Valley. For the current research, we expanded the set of variables…

010506 paleontologyOperations researchregional comparison[SHS.ARCHEO]Humanities and Social Sciences/Archaeology and PrehistoryComputer sciencefacteurs socio-culturelsSubject (philosophy)0211 other engineering and technologies02 engineering and technology01 natural sciencesdiachronic comparisonCultural heritage managementcomparaison diachronique0601 history and archaeology0105 earth and related environmental sciences021101 geological & geomatics engineeringcomparaison régionale[SHS.ARCHEO] Humanities and Social Sciences/Archaeology and Prehistory060102 archaeologyPredictive modellingRoman period.Cultural resources managementpériode romaine.06 humanities and the artsWork in processPopularityEpistemologysocio-cultural factors[ SHS.ARCHEO ] Humanities and Social Sciences/Archaeology and PrehistoryCriticismArchaeological heritageModélisation prédictivePredictive modelling
researchProduct

From Metaphor to Practice: Operationalizing the Analysis of Resilience Using System Dynamics Modelling

2017

This paper operationalizes an analysis of resilience for social-ecological systems using system dynamics (SD) modelling. Resilience is a versatile concept that continues to gain popularity among researchers who study ways to reduce the vulnerability of social-ecological systems to a wide range of disturbances. However, its application in the policymaking domain still remains underdeveloped because it is difficult to understand the mechanisms that might enhance resilience and to measure the impact of potential policies. This paper proposes to use SD modelling as a tool to analyse resilience using simulations to quantify system response to disturbances and a causal analysis to identify ways t…

0106 biological sciencesInformation Systems and ManagementOperationalizationManagement scienceMetaphorStrategy and Managementmedia_common.quotation_subject05 social sciencesVulnerabilityGeneral Social Sciences01 natural sciencesPopularitySystem dynamics010601 ecology0502 economics and businessSocio-ecological systemSet (psychology)Resilience (network)Psychology050203 business & managementmedia_commonSystems Research and Behavioral Science
researchProduct

Introducing postqualitative inquiry in sport and exercise psychology

2021

In recent years, qualitative research has gained popularity and legitimacy in sport and exercise psychology. However, this scientific discipline has not yet paid attention to postqualitative inquiry (PQI), despite the possibilities it offers for producing different knowledge and producing knowledge differently. The present article is the first attempt to rectify this lack of attention by offering a brief and partial sketch of PQI in the context of sport and exercise psychology. To start with, three of the basic propositions that enable PQI are described. These are: adopt a posthumanist view of ontology and the subject; engage with poststructuralism (necessarily) and new materialism (possibl…

03 medical and health sciences0302 clinical medicine05 social sciencesPosthumanism0501 psychology and cognitive sciences030229 sport sciencesSocial sciencePsychologyPopularity050105 experimental psychologyApplied PsychologyLegitimacyQualitative researchInternational Review of Sport and Exercise Psychology
researchProduct

Galerías de «mujeres ilustres» o el sinuoso camino de la excepción a la norma cotidiana (ss. XV-XVIII).

2000

Between the fifteenth and the eighteenth centuries, collections of «illustrious women» were a very widely spread genre all over Europe. Humanistic and courtly in their origins, they were linked to the discourse of women´s «excellence» and they transmitted the values of privilege and aristocratic ethics. At the same time, they showed ambivalent, disturbing and powerful images of «women on top». The fact that its popularity seems to have increased during the eighteenth century and that they took more widespread forms such as articles in the periodicals raises interesting questions about the meanings those images, opposed in many ways to Enlightenment values and attitudes, could have for eight…

050101 languages & linguisticsHistoryHistoryFifteenthCulturamedia_common.quotation_subjectEducaciónErudición.CultureDonesSocial SciencesHumanismMujeres; Cultura; Ilustración; Educación; Erudición.IlustraciónEducationlcsh:Social SciencesHerudición.Excellenceilustración0501 psychology and cognitive sciencesWomenmedia_commonEnlightenment05 social sciencesEnlightenmentMujeresculturaErudition.PopularityFemininitylcsh:HmujeresEducacióeducaciónHumanitiesWomen; Culture; Enlightenment; Education; Erudition.Privilege (social inequality)Period (music)Hispania : Revista española de historia
researchProduct

DE PRESSUPOSTOS SOBRE O CONHECIMENTO E A APRENDIZAGEM À PRÁXIS NA FORMAÇÃO DO TRADUTOR

2016

Este artigo discute o problema da ausência de programas acadêmicos de qualificação para professores de tradução que têm de recorrer às suas próprias intuições e à abordagem pedagógica popular. Objetiva identificar os entendimentos subjacentes da natureza do conhecimento e da aprendizagem que estão por trás da tradicional prática de ensino do “Quem quer vai fazer a primeira sentença?”, bem como das abordagens didáticas alternativas. Embora existam algumas publicações inspiradoras e motivadoras sobre metodologias inovadoras de ensino centradas no aluno, estas ainda carecem de discussões sobre a epistemologia pedagógica ou quaisquer princípios gerais ou teoria da educação. A principal tese pro…

060201 languages & linguistics0602 languages and literature05 social sciences050301 educationConstrutivismo. Emergentismo. Empirismo-racionalismo. Abordagem pedagógica popular. Epistemologia pedagógica.06 humanities and the artsGeneral Medicine0503 educationRevista Belas Infiéis
researchProduct

Analysis of New Concept English from the Perspective of Cross-cultural Communication–A Case Study in Book 2

2018

New Concept English (NCE) is a series of English language textbooks, four volumes in total, which have gained national popularity and wide acceptance by English teachers, learners and parents in China. In the academic circle, apart from the analysis of the contents of NCE, which has been mostly discussed, many contrast studies between NCE and other English course-books are not new topics either. This paper focuses on the analysis of NCE from the perspective of cross-cultural communication and develops a detailed study on the second volume based on eight parameters: norm, value, art, custom, religion, language, ways of life, material culture. Hopefully, the current study will shed new light …

060201 languages & linguisticsLinguistics and Language05 social sciences050301 educationCross-cultural communication06 humanities and the artsEnglish languagePopularityLanguage and Linguistics0602 languages and literatureMathematics educationLanguage educationNorm (social)SociologyChina0503 educationTheory and Practice in Language Studies
researchProduct

Crecimiento económico, regresión social, crispación política

2004

Otra versión del artículo "Balance de la era Aznar" (En: Le monde diplomatique - Edición Cono Sur, nº 58, abril de 2004).

11-MVidal-Beneyto JoséAznarEspañaPolíticaCrecimiento económicoEleccionesBerlusconiPublicaciones: Obra periodística: Columnas y artículos de opiniónFracasoRegresión socialUnión EuropeaAccidentes laboralesMercadoAntiterrorismoCoste socialMovilizacionesGuerra de IrakAtentadosParoBushPoderRajoyImpuestosDesempleoPartido popularPrivatizaciónGobiernoZapateroBlairPartidos políticosCrispación políticaÉxitoEmpleo
researchProduct

Le lourd héritage de l’ère Aznar

2004

La versión no publicada se titula "Un bilan convenu (sans surprise): croissance économique, crispation politique, régréssion sociale"

11-MVidal-Beneyto JoséAznarEspañaPolíticaEleccionesBerlusconiPublicaciones: Obra periodística: Columnas y artículos de opiniónFracasoUnión EuropeaAccidentes laboralesMercadoAntiterrorismoCoste socialMovilizacionesGuerra de IrakAtentadosParoBushPoderRajoyImpuestosDesempleoPartido popularPrivatizaciónGobiernoZapateroBlairPartidos políticosÉxitoEmpleo
researchProduct

Balance de la era Aznar

2004

Versión española de "Le lourd héritage de l’ère Aznar" (En: Le monde diplomatique, abril de 2004).

11-MVidal-Beneyto JosépoderAznarEspañapolíticacoste socialBerlusconiPublicaciones: Obra periodística: Columnas y artículos de opiniónUnión Europeapartido popularéxitopartidos políticoseleccionesBushantiterrorismoRajoyprivatizaciónZapateromovilizacionesparoguerra de IrakatentadosempleoimpuestosBlairgobiernodesempleomercadoaccidentes laboralesfracaso
researchProduct