Search results for "rake"

showing 6 items of 866 documents

The microstructure of bentonite clay

2018

Bentonite is a common clay having many applications. One of them will be in the spent nuclear fuel repository, as a buffer material between host rock and the canisters containing the radioactive waste. This application has high requirements for the material used, ranging from, among others, appropriate mechanical properties, chemical stability, fine porous structure to sufficient hydraulic conductivity. The material should maintain its properties over time as the life span of the repository is hundreds of thousands years. The aim of this thesis was to investigate the structure of bentonite clay in a condition similar to expected in the repository. The research focused mainly on the pore str…

mikrorakenteetbentonite claymateriaalitutkimushuokoisuuspore structuremicrostructurebentoniittivesipore watersavi
researchProduct

Mass Measurements of Proton-rich Nuclei with JYFLTRAP

2011

The Penning trap setup JYFLTRAP, connected to the IGISOL facility, has been extensively used for atomic mass measurements of exotic nuclei. On the proton rich side of the chart of nuclei mass measurements have mostly contributed to fundamental physics and nuclear astrophysics studies with about 100 atomic masses measured. peerReviewed

Condensed Matter::Quantum Gasesnuclear spectroscopyydinrakennenuclear physicsaccelerator-based physicsNuclear Theorynuclear structurePhysics::Atomic and Molecular ClustersydinspektroskopiaPhysics::Atomic PhysicsNuclear Experimentydinfysiikkakiihdytinpohjainen fysiikka
researchProduct

Signals of demographic expansion in Drosophila virilis

2008

Background. The pattern of genetic variation within and among populations of a species is strongly affected by its phylogeographic history. Analyses based on putatively neutral markers provide data from which past events, such as population expansions and colonizations, can be inferred. Drosophila virilis is a cosmopolitan species belonging to the virilis group, where divergence times between different phylads go back to the early Miocene. We analysed mitochondrial DNA sequence variation among 35 Drosophila virilis strains covering the species' range in order to detect demographic events that could be used to understand the present characteristics of the species, as well as its differences …

mtDNApopulaatiorakennepopulation structure
researchProduct

Structure-based evaluation of the resonance interactions and effectiveness of the charge transfer in nitroamines

2011

Structural data for five nitroamines of general formula Me₂N–G–NO₂ show effectiveness of the ground-state charge transfer to be most and least efficient in N,N-dimethylnitramine and in 4-N,N-dimethylamino-β-nitrostyrene, respectively. Electron-donor power of the amino nitrogen atom in the latter compound is less than that in 4-nitro-β-N,N-dimethylaminostyrene (these two compounds are isomers). Natural population analysis shows that the charge transfer from the amino to the nitro oxygen atoms is most effective in N,N-dimethylnitramine, Me₂N–NO₂. The nitro oxygen atoms are not the only acceptors of the negative charge lost by the amino nitrogen atom. The nitro group in two substituted nitrobe…

resonance interactionrakennevuorovaikutusresonancequantum-chemical calculationsnitroaminenitroamiiniresonanssi
researchProduct

Rakennustutkimus ja Avoimen tiedon keskus

2016

Avoimen tiedon keskusidentiteettimuseokulttuurihistoriarakennustutkimusdokumentointi
researchProduct

Interculturality

2023

kulttuurienvälinen vuorovaikutuskulttuurienvälinen viestintävaltarakenteetkulttuurienvälisyys
researchProduct