Search results for "raskaus"

showing 10 items of 34 documents

DNA methylation links prenatal smoking exposure to later life health outcomes in offspring

2019

Background Maternal smoking during pregnancy is associated with adverse offspring health outcomes across their life course. We hypothesize that DNA methylation is a potential mediator of this relationship. Methods We examined the association of prenatal maternal smoking with offspring blood DNA methylation in 2821 individuals (age 16 to 48 years) from five prospective birth cohort studies and perform Mendelian randomization and mediation analyses to assess whether methylation markers have causal effects on disease outcomes in the offspring. Results We identify 69 differentially methylated CpGs in 36 genomic regions (P value < 1 × 10−7) associated with exposure to maternal smoking in adolesc…

0301 basic medicinePhysiologyraskausDiseaseBioinformaticsEpigenesis Genetic/dk/atira/pure/core/keywords/icepCohort Studies0302 clinical medicinePregnancyGTP-Binding Protein gamma SubunitsEpidemiologySCHIZOPHRENIADiseaseLongitudinal StudiesProspective StudieskohorttitutkimusGenetics (clinical)Maternal smokingGenetics & HeredityRISK0303 health sciencesDNA methylationSmokingWIDEMethylationASSOCIATIONMiddle AgedDNA-metylaatio3. Good healthCausalityPREGNANCYOncologyMaternal ExposureSchizophreniaPrenatal Exposure Delayed Effects030220 oncology & carcinogenesisDNA methylationkausaliteettilifecourseLife course approachFemaleICEPLife Sciences & BiomedicineAdultTOBACCO-SMOKEMediation (statistics)medicine.medical_specialtyAdolescentOffspringBirth weightPersistenceYoung Adult03 medical and health sciencestupakointiterveysvaikutuksetMendelian randomizationGeneticsmedicineHumansMolecular BiologyMETAANALYSIS030304 developmental biologyPregnancyScience & TechnologyIDENTIFICATIONbusiness.industryMATERNAL CIGARETTE-SMOKINGResearchMediationLife courseMendelian Randomization Analysismedicine.diseaseBIRTH-WEIGHT030104 developmental biologyCpG Islandsbusiness030217 neurology & neurosurgeryGenome-Wide Association StudyDevelopmental Biology
researchProduct

The impact of maternal weight in pregnancy on glucose metabolism in non-diabetic offspring in late adulthood

2019

Aims: We aimed to examine the association between maternal adiposity and glucose metabolism in adult offspring without diabetes, simultaneous taking offspring own adiposity into account. Methods: This longitudinal birth cohort study (Helsinki Birth Cohort Study) included 1,440 non-diabetic subjects examined at a mean age of 62 years. Subjects were divided into quartiles according to maternal body mass index (BMI). The impact of maternal BMI on offspring body composition was also studied. Results: There were no differences in fasting glucose between the groups. In men, maternal BMI was inversely associated with mean 2-hour glucose concentration after a 75 g oral glucose tolerance test (p <0.…

Blood GlucoseMaleEndocrinology Diabetes and MetabolismCHILDHOODPhysiologyraskausOverweightCohort Studies0302 clinical medicineEndocrinologyPregnancyMedicineMass indexLongitudinal StudiesMUSCLE MASS030212 general & internal medicineaineenvaihduntaRISK2. Zero hungerGlucose metabolismINSULIN-RESISTANCEylipainoGeneral MedicineInsulin sensitivityäiditGestational Weight Gainmaternal obesityOBESITYAdult ChildrenFemaleHEALTHmedicine.symptomAdultOffspringglucose metabolismOffspring health030209 endocrinology & metabolismBMI03 medical and health sciencesaineenvaihduntahäiriötInsulin resistanceMaternal obesityDiabetes mellitusInternal MedicineHumansinsulin sensitivitylapset (perheenjäsenet)offspring healthPregnancyOVERWEIGHTbusiness.industrynutritional and metabolic diseasesinsuliiniresistenssimedicine.diseaseBODY-MASS INDEXPANCREATIC BETA-CELL3121 General medicine internal medicine and other clinical medicineLean body masslihavuusGAINbusinessBody mass indexDiabetes Research and Clinical Practice
researchProduct

Association of maternal prenatal smoking GFI1-locus and cardio-metabolic phenotypes in 18,212 adults

2018

Background: DNA methylation at the GFI1-locus has been repeatedly associated with exposure to smoking from the foetal period onwards. We explored whether DNA methylation may be a mechanism that links exposure to maternal prenatal smoking with offspring's adult cardio-metabolic health.Methods: We meta-analysed the association between DNA methylation at GFI1-locus with maternal prenatal smoking, adult own smoking, and cardio-metabolic phenotypes in 22 population-based studies from Europe, Australia, and USA (n= 18,212). DNA methylation at the GFI1-locus was measured in whole-blood. Multivariable regression models were fitted to examine its association with exposure to prenatal and own adult s…

Genetics and Molecular Biology (all)MaleNetherlands Twin Register (NTR)0301 basic medicineResearch paperGFI1 protein humanGFI1-locusraskausResearch & Experimental Medicinecardio-metabolic phenotypesBiochemistryEpigenesis GeneticGLOBAL Meth QTL Consortium0302 clinical medicinePregnancySmoke030212 general & internal medicinematernal prenatal smokingDNA METHYLATIONmedia_commonRISK2. Zero hungereducation.field_of_studySmokingta3142General MedicineMiddle Agedgenetics [Transcription Factors]3. Good healthDNA-Binding ProteinsPhenotypeMedicine Research & ExperimentalCARDIOVASCULAR-DISEASEepigenetiikkaPopulation SurveillancePrenatal Exposure Delayed EffectsDNA methylation/dk/atira/pure/sustainabledevelopmentgoals/good_health_and_well_beingFemaleDisease SusceptibilityBIOS ConsortiumMedical GeneticsLife Sciences & BiomedicineAdultmedicine.medical_specialtyOffspringBirth weightPopulationMothersgenetics [DNA-Binding Proteins]ta3111MethylationGeneral Biochemistry Genetics and Molecular BiologyDIET03 medical and health sciencesMedicine General & InternalSDG 3 - Good Health and Well-beingtupakointiGeneral & Internal MedicineInternal medicine/dk/atira/pure/keywords/cohort_studies/netherlands_twin_register_ntr_medicinemedia_common.cataloged_instanceHumansddc:610adverse effects [Maternal Exposure]EXPOSUREEpigeneticsEuropean unioneducationMedicinsk genetikEPIGENOME-WIDE ASSOCIATIONPregnancyBiochemistry Genetics and Molecular Biology (all)Science & Technologybusiness.industryadverse effects [Smoking]DNA Methylationta3121medicine.diseaseBIRTH-WEIGHT030104 developmental biologyEndocrinologyGenetic Locisydän- ja verisuonitauditCpG IslandsCIGARETTE-SMOKINGCESSATIONEnergy Metabolismmetabolism [Myocardium]businessBody mass indexBiomarkersTranscription FactorsEBioMedicine
researchProduct

Hopsin laatimisen haasteet : tapaustutkimus raskaana olevan yhdeksäsluokkalaisen oppilaan hops-prosessin etenemisestä

2005

HOPSperuskoulun yläasteopinto-ohjausraskausopetussuunnitelmatoppimistavoitteet
researchProduct

Physical Activity and Body Composition in Children and Their Mothers According to Mother’s Gestational Diabetes Risk: A Seven-Year Follow-Up Study

2019

Background and Objectives: There is lack of knowledge on whether mothers&rsquo

Malegenetic structuresraskausOverweightraskausdiabetesBody Mass IndexPregnancyRisk FactorsAccelerometryfollow-upCluster AnalysisMedicineFamily historyChildlcsh:R5-920diabetesexerciseObstetricsSisätaudit - Internal medicineNaisten- ja lastentaudit - Gynaecology and paediatricsGeneral MedicineriskitekijätäiditGestational diabetesFemaleseurantatutkimusmedicine.symptomlcsh:Medicine (General)Bioelectrical impedance analysisfyysinen aktiivisuusAdultmedicine.medical_specialtypediatricsMotherslapset (ikäryhmät)ArticleDiabetes mellitusexercise; gestational diabetes risk factors; pediatrics; body composition; follow-upHumansRisk factorkehonkoostumusPregnancybody compositionbusiness.industrymedicine.diseaseDiabetes Gestationalgestational diabetes risk factorsbusinessBody mass indexFollow-Up StudiesMedicina
researchProduct

Chernobyl exposure as stressor during pregnancy and hormone levels in adolescent offspring

2008

Background: Animal research suggests a programming effect of prenatal stress in the fetal period, resulting in disruptions in behavioural and neuromotor development. Physiological changes that mediate these effects include alterations in the hypothalamic-pituitary-adrenal axis and in testosterone levels. This human study focuses on changes related to these physiological systems after prenatal stress exposure. Methods: We examined the potential effect of prenatal stress associated with the Chernobyl disaster in an ongoing genetic epidemiological study in Finland. One birth cohort of twins (n = 121 twin pairs) was exposed in utero to maternal stress, and their saliva cortisol and testosterone…

Malemedicine.medical_specialtyHypothalamo-Hypophyseal SystemAdolescentHydrocortisoneEpidemiologyPrenatal ProgrammingPopulationPituitary-Adrenal SystemraskausArticle03 medical and health sciences0302 clinical medicinePregnancyInternal medicineMedicineHumansTestosteroneeducationSalivaFinland030304 developmental biologyHydrocortisone0303 health sciencesPregnancyeducation.field_of_studybusiness.industryStressorPubertyPublic Health Environmental and Occupational HealthTestosterone (patch)medicine.diseaseTwin studyPregnancy ComplicationsEndocrinologyPrenatal stressChernobyl Nuclear AccidentMaternal ExposurePrenatal Exposure Delayed EffectsFemalePregnancy Trimestersbusiness030217 neurology & neurosurgeryStress Psychologicalmedicine.drug
researchProduct

A Smartphone App to Promote Healthy Weight Gain, Diet, and Physical Activity During Pregnancy (HealthyMoms): Protocol for a Randomized Controlled Tri…

2019

BACKGROUND: Excessive gestational weight gain is common and associated with adverse outcomes both in the short and long term. Although traditional lifestyle-based interventions have shown to mitigate excess gestational weight gain, little is known about whether mobile Health (mHealth) apps can promote healthy weight gain, diet, and physical activity during pregnancy. OBJECTIVE: The primary aim of the HealthyMoms trial is to determine the effectiveness of a smartphone app (HealthyMoms) for mitigating excess gestational weight gain during pregnancy. Secondary aims are to determine the effectiveness of the app on dietary habits, physical activity, body fatness, and glycemia during pregnancy. M…

Original Papermobile phoneNutrition and DieteticsexercisekuntoliikuntaraskaussmartphonepainonhallintatelelääketiedeNäringsläragestational weight gainmobiilisovelluksettelemedicinepregnancyteleterveydenhuoltodietJMIR Research Protocols
researchProduct

Maternal body mass index, change in weight status from childhood to late adulthood and physical activity in older age

2021

This study aimed to examine the longitudinal associations of maternal body mass index (BMI), weight status in childhood and late adulthood and device-measured total physical activity (TPA) in older age. The study involves 552 participants from Helsinki Birth Cohort Study who were born in Helsinki, Finland, in 1934-1944. TPA was measured with a multisensory body monitor at a mean age of 70 years and expressed in metabolic equivalent of task hours/day (METh/d). Childhood overweight (BMI > 85th percentile) was based on school health records at 6-7 years of age, and late adulthood overweight (BMI >= 25 kg/m(2)) was based on clinical measurements at the mean age of 61 years. Childhood overweight…

PercentileAgingPediatric Obesityobesityphysical activityraskaus030204 cardiovascular system & hematologyOverweightliikuntaMetabolic equivalentBody Mass Indexchemistry.chemical_compound0302 clinical medicineMedicineOrthopedics and Sports MedicineMass indexLongitudinal Studies315 Sport and fitness sciencesChildFinland2. Zero hungerRISKylipainoMiddle AgedäiditTIMEmaternal obesityFemalemedicine.symptomfyysinen aktiivisuusPhysical activityMothersPhysical Therapy Sports Therapy and Rehabilitationlapset (ikäryhmät)terveyden edistäminenDIET03 medical and health sciencesterveysvaikutuksetHumansoverweightExerciseAgedbusiness.industryENERGY-EXPENDITURE030229 sport sciencesMeth-lapsuusmedicine.diseaseObesityConfidence intervalchemistry3121 General medicine internal medicine and other clinical medicineLinear ModelsBody-Weight TrajectoryGAINbusinessDemography
researchProduct

"Älä epäröi kirjoittaa minulle kaikesta, mitä ajattelet" : avioliitto, äitiys ja perhe-elämä Englannin kuningatar Viktorian kirjeissä vanhimmalle tyt…

2009

Viktoriasynnytyskirjeenvaihtoavioliittoraskausäitiyskuolemaperhe-elämäIso-Britanniakuningashuoneet1800-luku
researchProduct

Physical activity during pregnancy and early childhood from the perspective of gestational diabetes risk and children's body composition

2017

This study investigated the factors associated with self-reported leisure-time physical activity excluding household activities (LTPAexHH) among women at risk for gestational diabetes (GDM), change in self-reported LTPA including household activities (LTPAinHH) from pre-pregnancy to 7-year follow-up as well as the influence of risk for GDM on their children’s physical activity (PA) and body composition. The association between maternal and child PA, and associations of PA with body composition and physical fitness in preschoolers were also studied. A sample of 399 pregnant women at risk for GDM was examined in a cohort study, and 199 mother-child dyads were assessed in cross-sectional and l…

body compositiongestational diabetes riskphysical activitylapset (ikäryhmät)raskausriskitekijätliikuntaraskausdiabetesäiditsikiönkehityspainonhallintavarhaislapsuusfyysinen kuntochildrenleikki-ikäisetesikouluikäisetterveysvaikutuksetphysical fitnesspregnancyfyysinen aktiivisuuskehonkoostumus
researchProduct