Search results for "resonance"

showing 10 items of 6625 documents

Double resonance response in nonlinear magnetic vortex dynamics

2013

We present experimental evidences for the dynamical bifurcation behavior of ac-driven magnetic vortex core gyration in a ferromagnetic disk. The dynamical bifurcation, i.e., appearance and disappearance of two stable dynamical states in the vortex gyration, occurring as the amplitude of the driving Oersted field increases to ${B}_{Oe}g{B}_{Oe}^{cr}$, manifests itself in a double resonance response in the dependence of homodyne the dc-voltage signal on the frequency $\ensuremath{\omega}$ of the applied microwave current. We find that the frequency range $\ensuremath{\delta}\ensuremath{\omega}$ between the two resonance features strongly increases with the excitation power. Our analysis based…

010302 applied physicsPhysicsCondensed matter physicsField (physics)ResonanceCondensed Matter Physics01 natural sciencesGyrationElectronic Optical and Magnetic MaterialsVortexAmplitudeFerromagnetismNonlinear resonance0103 physical sciences010306 general physicsExcitationPhys. Rev. B 88, 064402
researchProduct

Electron cyclotron resonance ion sources – physics, technology and future challenges

2017

This article has no abstract. peerReviewed

010302 applied physicsPhysicsECR ion sourcesta114Physics::Plasma PhysicsPhysicsQC1-9990103 physical sciences01 natural sciencesEngineering physicsElectron cyclotron resonance010305 fluids & plasmasIonEPJ Web of Conferences
researchProduct

Radiofrequency and 2.45 GHz electron cyclotron resonance H−volume production ion sources

2016

The volume production of negative hydrogen ions () in plasma ion sources is based on dissociative electron attachment (DEA) to rovibrationally excited hydrogen molecules (H2), which is a two-step process requiring both, hot electrons for ionization, and vibrational excitation of the H2 and cold electrons for the formation through DEA. Traditionally ion sources relying on the volume production have been tandem-type arc discharge sources equipped with biased filament cathodes sustaining the plasma by thermionic electron emission and with a magnetic filter separating the main discharge from the formation volume. The main motivation to develop ion sources based on radiofrequency (RF) or electro…

010302 applied physicsPhysicsGeneral Physics and AstronomyPlasmaElectron01 natural sciencesElectron cyclotron resonanceIon sourceCathode010305 fluids & plasmasIonlaw.inventionElectric arclawIonization0103 physical sciencesAtomic physicsNew Journal of Physics
researchProduct

Synchronous precessional motion of multiple domain in a ferromagnetic nanowire by perpendicular field pulses

2014

Magnetic storage and logic devices based on magnetic domain wall motion rely on the precise and synchronous displacement of multiple domain walls. The conventional approach using magnetic fields does not allow for the synchronous motion of multiple domains. As an alternative method, synchronous current-induced domain wall motion was studied, but the required high-current densities prevent widespread use in devices. Here we demonstrate a radically different approach: we use out-of-plane magnetic field pulses to move in-plane domains, thus combining field-induced magnetization dynamics with the ability to move neighbouring domain walls in the same direction. Micromagnetic simulations suggest …

010302 applied physicsPhysicsMagnetization dynamicsMultidisciplinaryMagnetic domainCondensed matter physicsField (physics)Magnetic storageGeneral Physics and Astronomy02 engineering and technologyGeneral Chemistry021001 nanoscience & nanotechnology01 natural sciencesGeneral Biochemistry Genetics and Molecular BiologyDisplacement (vector)Articlelaw.inventionDomain (software engineering)Magnetic fieldNuclear magnetic resonanceDomain wall (magnetism)law0103 physical sciencesddc:5300210 nano-technologyNature Communications
researchProduct

The effect of plasma electrode collar structure on the performance of the JYFL 14GHz electron cyclotron resonance ion source

2013

Abstract The influence of a so-called collar structure on the performance of the JYFL 14 GHz electron cyclotron resonance ion source (ECRIS) has been studied experimentally at the Department of Physics, University of Jyvaskyla (JYFL). The collar is a cylindrical structure extruding inwards from the plasma electrode. The collar length was varied between 5 and 60 mm. For some ion species a moderate performance improvement was achieved in terms of extracted beam current and transverse emittance up to 30 mm collar length. Longer collars resulted in a substantial performance decrease. Different collar materials, i.e. nonmagnetic stainless steel, aluminum and Al 2 O 3 , and a wide range of ion sp…

010302 applied physicsPhysicsNuclear and High Energy Physicsta114Plasma01 natural sciences7. Clean energyElectron cyclotron resonanceIon source010305 fluids & plasmasCollarIon0103 physical sciencesElectrodeThermal emittanceddc:530Atomic physicsInstrumentationBeam (structure)
researchProduct

Interferences in Locally Resonant Sonic Metamaterials Formed from Helmholtz Resonators

2019

[EN] The emergence of materials artificially designed to control the transmission of waves, generally called metamaterials, has been a hot topic in the field of acoustics for several years. The design of these metamaterials is usually carried out by overlapping different wave control mechanisms. An example of this trend is the so-called Locally Resonant Sonic Materials, being one of them the Phononic Crystals with a local resonant structure. These metamaterials are formed by sets of isolated resonators in such a way that the control of the waves is carried out by resonances and by the existence of Bragg bandgaps, which appear due to the ordered distribution of the resonators. Their use is b…

010302 applied physicsPhysicsPhysics and Astronomy (miscellaneous)Field (physics)AcousticsMetamaterialResonancePhysics::Optics02 engineering and technologyLow frequency021001 nanoscience & nanotechnology01 natural sciencesFinite element methodResonatorCoupling (physics)symbols.namesakeHelmhotz resonatorsHelmholtz free energyMetamaterialsFISICA APLICADA0103 physical sciencessymbols0210 nano-technology
researchProduct

Broadband microwave emission spectrum associated with kinetic instabilities in minimum-B ECR plasmas

2017

Plasmas of electron cyclotron resonance ion sources (ECRISs) are prone to kinetic instabilities due to the resonant heating mechanism resulting in anisotropic electron velocity distribution. Frequently observed periodic oscillations of extracted ion beam current in the case of high plasma heating power and/or strong magnetic field have been proven to be caused by cyclotrontype instabilities leading to a notable reduction and temporal variation of highly charged ion production. Thus, investigations of such instabilities and techniques for their suppression have become important topics in ECRIS research. The microwave emission caused by the instabilities contains information on the electron e…

010302 applied physicsPhysicsRange (particle radiation)microwave sourcesIon sourcesIon beamta114Highly charged ionPlasmaAstrophysics::Cosmology and Extragalactic Astrophysicsplasma instabilitiesmagnetic fieldsCondensed Matter PhysicsPlasma oscillationmagneettikentät01 natural sciences7. Clean energyElectron cyclotron resonanceIonPhysics::Plasma Physicsmicrowave spectra0103 physical sciencesAtomic physics010306 general physicsMicrowave
researchProduct

High efficiency resonance ionization of palladium with Ti:sapphire lasers

2016

This work presents the development and testing of highly efficient excitation schemes for resonance ionization of palladium. To achieve the highest ionization efficiencies, a high-power, high repetition rate Ti:sapphire laser system was used and 2-step, 3-step and 4-step schemes were investigated and compared. Starting from different excited steps, the frequencies of the final ionization steps were tuned across the full accessible spectral range of the laser system, revealing several autoionizing Rydberg series, which converge towards the energetically higher lying state of the Pd+ ion ground state configuration. Through proper choice of these excitation steps, we developed a highly efficie…

010302 applied physicsPhysicsResonanceCondensed Matter PhysicsLaser01 natural sciencesAtomic and Molecular Physics and OpticsIon sourcelaw.inventionIonlawIonizationExcited state0103 physical sciencesPhysics::Atomic PhysicsAtomic physics010306 general physicsGround stateExcitationJournal of Physics B: Atomic, Molecular and Optical Physics
researchProduct

Measurements of the energy distribution of electrons lost from the minimum B-field -- the effect of instabilities and two-frequency heating

2020

Further progress in the development of ECR ion sources (ECRIS) requires deeper understanding of the underlying physics. One of the topics that remains obscure, though being crucial for the performance of the ECRIS, is the electron energy distribution (EED). A well-developed technique of measuring the EED of electrons escaping axially from the magnetically confined plasma of an ECRIS was used for the study of EED in unstable mode of plasma confinement, i.e. in the presence of kinetic instabilities. The experimental data were recorded for pulsed and CW discharges with a room-temperature 14 GHz ECRIS at the JYFL accelerator laboratory. The measurements were focused on observing differences bet…

010302 applied physicsPhysicsResonanceFOS: Physical sciencesPlasmaElectronhiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesPhysics - Plasma PhysicsElectron cyclotron resonanceIon source010305 fluids & plasmasMagnetic fieldIonPlasma Physics (physics.plasm-ph)Magnetic trap0103 physical sciencesAtomic physicsInstrumentation
researchProduct

Effects of magnetic configuration on hot electrons in a minimum-B ECR plasma

2020

International audience; To investigate the hot electron population and the appearance of kinetic instabilities in highly charged electron cyclotron resonance ion source (ECRIS), the axially emitted bremsstrahlung spectra and microwave bursts emitted from ECRIS plasma were synchronously measured on SECRAL-II (Superconducting ECR ion source with Advanced design in Lanzhou No. II) ion source with various magnetic field configurations. The experimental results show that when the ratio of the minimum field to the resonance field (i.e. Bmin/Becr ) is less than ~0.8, the bremsstrahlung spectral temperature Ts increases linearly with the Bmin/Becr –ratio when the injection, extraction and radial mi…

010302 applied physicsPhysics[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Cyclotron resonanceBremsstrahlungResonancePlasmaCondensed Matter Physics01 natural sciencesElectromagnetic radiationElectron cyclotron resonance010305 fluids & plasmasMagnetic fieldNuclear Energy and Engineering0103 physical sciencesAtomic physicsMicrowave
researchProduct