Search results for "s.p.a."

showing 10 items of 12298 documents

Time resolved measurements of hydrogen ion energy distributions in a pulsed 2.45 GHz microwave plasma

2017

A plasma diagnostic study of the Ion Energy Distribution Functions (IEDFs) of H+, H+2H2+, and H+3H3+ ions in a 2.45 GHz hydrogen plasma reactor called TIPS is presented. The measurements are conducted by using a Plasma Ion Mass Spectrometer with an energy sector and a quadrupole detector from HIDEN Analytical Limited in order to select an ion species and to measure its energy distribution. The reactor is operated in the pulsed mode at 100 Hz with a duty cycle of 10% (1 ms pulse width). The IEDFs of H+, H+2H2+, and H+3H3+ are obtained each 5 μs with 1 μs time resolution throughout the entire pulse. The temporal evolution of the plasma potential and ion temperature of H+ is derived from the d…

010302 applied physicsPhysicsRange (particle radiation)plasma sourcesta114plasma diagnosticsPlasmaCondensed Matter PhysicsMass spectrometry01 natural sciences7. Clean energyIon source010305 fluids & plasmasIonplasma dynamicsPhysics::Plasma Physics0103 physical sciencesThermal emittancePlasma diagnosticsionAtomic physicsMicrowaveplasma sheathsPhysics of Plasmas
researchProduct

Measurements of the energy distribution of electrons lost from the minimum B-field -- the effect of instabilities and two-frequency heating

2020

Further progress in the development of ECR ion sources (ECRIS) requires deeper understanding of the underlying physics. One of the topics that remains obscure, though being crucial for the performance of the ECRIS, is the electron energy distribution (EED). A well-developed technique of measuring the EED of electrons escaping axially from the magnetically confined plasma of an ECRIS was used for the study of EED in unstable mode of plasma confinement, i.e. in the presence of kinetic instabilities. The experimental data were recorded for pulsed and CW discharges with a room-temperature 14 GHz ECRIS at the JYFL accelerator laboratory. The measurements were focused on observing differences bet…

010302 applied physicsPhysicsResonanceFOS: Physical sciencesPlasmaElectronhiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesPhysics - Plasma PhysicsElectron cyclotron resonanceIon source010305 fluids & plasmasMagnetic fieldIonPlasma Physics (physics.plasm-ph)Magnetic trap0103 physical sciencesAtomic physicsInstrumentation
researchProduct

Fundamental Noise Limits and Sensitivity of Piezoelectrically Driven Magnetoelastic Cantilevers

2020

International audience; Magnetoelastic sensors for the detection of low-frequency and low-amplitude magnetic fields are in the focus of research for more than 30 years. In order to minimize the limit of detection (LOD) of such sensor systems, it is of high importance to understand and to be able to quantify the relevant noise sources. In this contribution, cantilever-type electromechanical and magnetoelastic resonators, respectively, are comprehensively investigated and mathematically described not only with regard to their phase sensitivity but especially to the extent of the sensor-intrinsic phase noise. Both measurements and calculations reveal that the fundamental LOD is limited by addi…

010302 applied physicsPhysics[SPI.OTHER]Engineering Sciences [physics]/OtherCantileverMagnetic domainMechanical EngineeringAcousticsMagnetostriction02 engineering and technology021001 nanoscience & nanotechnology01 natural sciencesMagnetic fieldVibrationResonatorMagnet0103 physical sciencesPhase noiseElectrical and Electronic Engineering0210 nano-technology
researchProduct

Controlled Cytotoxicity of Plasma Treated Water Formulated By Open-air Hybrid Mode Discharge

2017

Plasma‐activated liquids (PAL) attract increasing interest with demonstrated biological effects. Plasma exposure in air produces stable aqueous reactive species which can serve as chemical diagnostics of PAL systems. Here, we tailor aqueous reactive species inside plasma‐activated water (PAW) through treating water with AC air spark and glow discharges in contact with water. Chemical probing demonstrated species specificity between two types of PAW. Spark discharge PAW contains urn:x-wiley:14381656:media:ppap201600207:ppap201600207-math-0006 and urn:x-wiley:14381656:media:ppap201600207:ppap201600207-math-0007, while urn:x-wiley:14381656:media:ppap201600207:ppap201600207-math-0008and urn:x-w…

010302 applied physicsPlant growthChromatographyPhysics and Astronomy (miscellaneous)Treated waterChemistry02 engineering and technologyPlasmaHuman decontaminationglow discharge021001 nanoscience & nanotechnology01 natural scienceschemistry.chemical_compoundEnvironmental chemistryelectrolysis0103 physical sciencesNitritereactive species0210 nano-technologyHydrogen peroxideCytotoxicityBiologyOpen airplasma-activated waterspark discharge
researchProduct

Determination of elastoplastic properties of TiO2 thin films deposited on dual phase stainless steel using nanoindentation tests

2010

International audience; In recent years, the extraction of mechanical behaviour of thin films by nanoindentation using sharp indenter geometry has been extensively studied. This work investigates the mechanical properties of TiO2 thin film (1 µm thickness) deposited by spin coating on dual phase Duplex stainless steel and glass substrates. Experiments are carried out with different sharp triangular pyramids (a Cube corner and a Berkovich indenter) using a commercial Nano Indenter® XP apparatus. The substrate effect has been counteracted and an inverse method proposed in literature for bulk material has been adapted to assess the elastoplastic parameters of the tested thin film directly from…

010302 applied physicsSpin coatingMaterials scienceThin filmsMetallurgy02 engineering and technologySurfaces and InterfacesGeneral ChemistrySubstrate (electronics)Inverse methodNanoindentation021001 nanoscience & nanotechnologyCondensed Matter Physics01 natural sciencesFinite element methodNanoindentationSurfaces Coatings and FilmsPhase (matter)0103 physical sciencesNano-Materials ChemistryThin film0210 nano-technologyFinite element modelingElastic modulus
researchProduct

An Experimental Study of Waveguide Coupled Microwave Heating with Conventional Multicusp Negative Ion Source

2015

Negative ion production with conventional multicusp plasma chambers utilizing 2.45 GHz microwave heating is demonstrated. The experimental results were obtained with the multicusp plasma chambers and extraction systems of the RFdriven RADIS ion source and the filament driven arc discharge ion source LIISA. A waveguide microwave coupling system, which is almost similar to the one used with the SILHI ion source, was used. The results demonstrate that at least one third of negative ion beam obtained with inductive RF-coupling (RADIS) or arc discharge (LIISA) can be achieved with 1 kW of 2.45 GHz microwave power in CW mode without any modification of the plasma chamber. The co-extracted electro…

010302 applied physicsWaveguide (electromagnetism)Materials scienceFOS: Physical sciencesPlasmaElectron7. Clean energy01 natural sciencesIon sourcePhysics - Plasma Physics010305 fluids & plasmasIonPlasma Physics (physics.plasm-ph)Electric arcPhysics::Plasma Physics0103 physical sciencesAtomic physicsMicrowaveBeam (structure)
researchProduct

Ion source research and development at University of Jyväskylä: Studies of different plasma processes and towards the higher beam intensities

2015

MonPS16; International audience; The long-term operation of high charge state electron cyclotron resonance ion sources fed withhigh microwave power has caused damage to the plasma chamber wall in several laboratories.Porosity, or a small hole, can be progressively created in the wall on a year time scale, which cancause a water leak from the cooling system into the plasma chamber vacuum. A burnout of theVENUS chamber is investigated. Information on the hole formation and on the necessary localhot electron power density is presented. Next, the hot electron flux to the wall is studied bymeans of simulations. First, the results of a simple model assuming that electrons are fullymagnetized and …

010302 applied physicsbeam intensityMaterials scienceta114ta213plasma diagnostics[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Cyclotron resonanceElectronPlasma7. Clean energy01 natural sciencesElectron cyclotron resonanceIon source010305 fluids & plasmasIonBeamlinePhysics::Plasma Physics0103 physical scienceselectron cyclotron resonance ion sourcesPlasma diagnosticsAtomic physicsInstrumentation
researchProduct

Estimating ion confinement times from beam current transients in conventional and charge breeder ECRIS

2019

International audience; Cumulative ion confinement times are probed by measuring decaying ion current transients in pulsed material injection mode. The method is applied in a charge breeder and conventional ECRIS yielding mutually corroborative results. The cumulative confinement time estimates vary from approximately 2 ms–60 ms with a clear dependence on the ion charge-to-mass ratio—higher charges having longer residence times. The long cumulative confinement times are proposed as a partial explanation to recently observed unexpectedly high ion temperatures. The results are relevant for rare ion beam (RIB) production as the confinement time and the lifetime of stable isotopes can be used f…

010302 applied physicsplasma sourcesMaterials scienceplasma diagnosticsIon beamStable isotope ratio[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Ion currentCharge (physics)plasmatekniikka7. Clean energy01 natural sciences010305 fluids & plasmasIonion sourcesplasma dischargesBreeder (animal)0103 physical sciencesAtomic physicsCurrent (fluid)InstrumentationBeam (structure)
researchProduct

Hydrogen bonding interaction of N5H with water: A first principle calculations

2019

Abstract The cyclopentazol (N5H) and its anion counterpart (N5–) have been studied extensively over the years and detected in the gas phase as well as in solution recently. In the present investigation, an attempt has been made to understand the interaction with water molecule using first principle calculations. Nature of interactions have been studied using both energy decomposition analysis and atoms in molecule (AIM) theory calculations. Further, the strength of non-covalent interactions were analysed using IGMplots.

010304 chemical physicsChemistryHydrogen bond010402 general chemistryCondensed Matter PhysicsDecomposition analysis01 natural sciencesBiochemistry0104 chemical sciencesGas phaseIonChemical physics0103 physical sciencesFirst principleMolecule[CHIM]Chemical SciencesPhysical and Theoretical Chemistry
researchProduct

A novel MALDI-MS approach for the analysis of neutral metallosupramolecular architectures

2011

Matrix assisted laser desorption/ionisation mass spectrometry (MALDI-MS) methods have been developed for the characterisation of neutral [2×2] metallogrids derived fromdiimine, dihydrazone and diacylhydrazone ligands. Such grids may be protonated in solution to give cationic species but in most cases these are labile, so that rather delicate conditions are required for observation of the intact metallogrids as monoprotonated derivatives in the gas phase. As a MALDI matrix, 2,4,6-trihydroxyacetophenone (THAP) is sufficiently acidic to enable monoprotonation of the grids unaccompanied by dissociation, and if the grid sample is initially deposited by a layering technique to avoid any prelimina…

010405 organic chemistryChemistryAnalytical chemistrySupramolecular chemistryCrystal structure010402 general chemistryMass spectrometryGrid01 natural sciencesDissociation (chemistry)0104 chemical sciencesInorganic ChemistryCluster (physics)Mass spectrum[CHIM]Chemical Sciencesta116StoichiometryComputingMilieux_MISCELLANEOUS
researchProduct