Search results for "sant"

showing 10 items of 2727 documents

Lifetime, 5-year and past-year prevalence of homelessness in Europe: a cross-national survey in eight European nations

2019

ObjectivesTo examine the lifetime, 5-year and past-year prevalence of homelessness among European citizens in eight European nations.DesignA nationally representative telephone survey using trained bilingual interviewers and computer-assisted telephone interview software.SettingThe study was conducted in France, Ireland, Italy, the Netherlands, Poland, Portugal, Spain and Sweden.ParticipantsEuropean adult citizens, selected from opt-in panels from March to December 2017. Total desired sample size was 5600, with 700 per country. Expected response rates of approximately 30% led to initial sample sizes of 2500 per country.Main outcome measuresHistory of homelessness was assessed for lifetime, …

AdultMalemedicine.medical_specialtyTime FactorsAdolescent[SDV]Life Sciences [q-bio]prevalenceService useSociodemographic dataHealthcare improvement science Radboud Institute for Health Sciences [Radboudumc 18]03 medical and health sciencesHealth servicesYoung Adult0302 clinical medicineRisk FactorsSurveys and QuestionnairesmedicineHumans1724030212 general & internal medicine150610. No inequalitySociodemographic datahomelessnessAgedOriginal ResearchAged 80 and overbusiness.industryeuropean adult citizensEurope; homelessness; prevalence; public healthCross national surveyPublic health1. No povertyGeneral MedicineMiddle Aged3. Good healthTelephone surveyEuropeTelephone interviewSocioeconomic FactorsSample size determinationIll-Housed PersonsLinear ModelsFemale[SDV.SPEE]Life Sciences [q-bio]/Santé publique et épidémiologiePublic Healthbusiness030217 neurology & neurosurgeryDemographyBMJ Open
researchProduct

Comparative neurocognitive effects of lithium and anticonvulsants in long-term stable bipolar patients

2015

Background: The aim of choosing a mood-stabilizing drug (lithium or anticonvulsants) or a combination of them with minimal neurocognitive effects is to stimulate the development of criteria for a therapeutic adequacy, particularly in Bipolar Disorder (BD) patients who are clinically stabilized. Method: Three groups of BD patients were established according to their treatment: (i) lithium monotherapy (n=29); (ii) lithium together with one or more anticonvulsants (n=28); and (iii) one or more anticonvulsants (n=16). A group of healthy controls served as the control (n=25). The following tests were applied: Wechsler Adult Intelligence Scale, Trail Making Test, Wechsler Memory Scale, Rey Comple…

AdultMalemedicine.medical_specialtyWechsler Memory ScaleBipolar DisorderTrail Making TestNeuropsychological TestsAudiologyExecutive FunctionYoung Adult03 medical and health sciences0302 clinical medicineVisual memoryWisconsin Card Sorting TestAntimanic AgentsmedicineHumansAttentionWorking memoryWechsler Adult Intelligence ScaleMiddle AgedExecutive functions030227 psychiatryPsychiatry and Mental healthClinical PsychologyMemory Short-TermLithium CompoundsAnticonvulsantsDrug Therapy CombinationFemaleCognition DisordersPsychologyNeurocognitive030217 neurology & neurosurgeryClinical psychologyJournal of Affective Disorders
researchProduct

First clinical postmarketing experiences in the treatment of epilepsies with brivaracetam: a retrospective observational multicentre study.

2019

ObjectivesBrivaracetam (BRV) is the latest approved antiepileptic drug and acts as a synaptic vesicle protein 2A ligand. The aim of the present study was to evaluate the efficacy and tolerability of BRV in the clinical setting.DesignRetrospective, observational multicentre study.SettingWe retrospectively collected clinical data of patients who received BRV in 10 epilepsy centres using a questionnaire that was answered by the reporting neurologist.ParticipantsData of 615 epilepsy patients treated with BRV were included in the study.Primary and secondary outcome measuresEfficacy regarding seizure frequency and tolerability of BRV were evaluated. Descriptive statistics complemented by X2 conti…

AdultMalemedicine.medical_specialtylevetiracetamefficacyBrivaracetam03 medical and health sciencesEpilepsyYoung Adult0302 clinical medicineInternal medicinemedicineProduct Surveillance PostmarketingHumansIn patient030212 general & internal medicine1506tolerabilityAdverse effectRetrospective StudiesOriginal ResearchSeizure frequencyEpilepsybrivaracetambusiness.industryGeneral MedicineMiddle Agedmedicine.diseasePyrrolidinonesadverse eventsTreatment OutcomeTolerabilityNeurologymonotherapy1713Observational studyAnticonvulsantsFemaleLevetiracetambusiness030217 neurology & neurosurgerymedicine.drugBMJ open
researchProduct

Therapeutic Drug Monitoring of the Antidepressant Mirtazapine and Its N-Demethylated Metabolite in Human Serum

2004

Mirtazapine is a novel antidepressant that acts by enhancing serotonergic and noradrenergic neurotransmission. Because very little is known about serum concentrations in relation to clinical effects, the use of therapeutic drug monitoring is so far unclear. A rapid automated HPLC method with fluorescence detection was developed for routine quantification of mirtazapine and its demethylated metabolite N-desmethylmirtazapine in human serum. The precision of the method was suitable because the day-to-day (n = 7) coefficient of variation (CV) of mirtazapine was 9.8, 4.2, and 5.1% for concentrations of 10, 40, and 80 ng/mL, respectively, and the CV for N-desmethylmirtazapine were 11.6, 10.3, and…

AdultMalemedicine.medical_specialtymedicine.medical_treatmentMetaboliteCoefficient of variationMirtazapineMirtazapineMianserinPharmacologySensitivity and Specificitychemistry.chemical_compoundInternal medicinemedicineHumansPharmacology (medical)AmisulprideAntipsychoticChromatography High Pressure LiquidAgedPharmacologySertralinemedicine.diagnostic_testbusiness.industryMiddle AgedEndocrinologychemistryTherapeutic drug monitoringHistamine H1 AntagonistsAntidepressantFemaleDrug Monitoringbusinessmedicine.drugTherapeutic Drug Monitoring
researchProduct

Telemedicine for the acute management of stroke in Burgundy, France: an evaluation of effectiveness and safety

2016

Background In the context of the development of telemedicine in France to address low thrombolysis rates and limited stroke infrastructures, a star-shaped telestroke network was implemented in Burgundy (1.6 million inhabitants). We evaluated the safety and effectiveness of this network for thrombolysis in acute ischemic stroke patients. Methods One hundred and thirty-two consecutive patients who received intravenous thrombolysis during a telemedicine procedure (2012–2014) and 222 consecutive patients who were treated at the stroke center of Dijon University Hospital, France (2011–2012) were included. Main outcomes were the modified Rankin scale (mRS) score and case fatality at 3 months. Com…

AdultMalemedicine.medical_specialtythrombolysismedicine.medical_treatmentContext (language use)030204 cardiovascular system & hematologyLogistic regressionBrain Ischemia03 medical and health sciences0302 clinical medicineFibrinolytic AgentsModified Rankin ScaleNeoplasmsCase fatality ratemedicineHumansThrombolytic TherapyIntensive care medicineStrokeAgedAged 80 and overbusiness.industry[ SDV.SPEE ] Life Sciences [q-bio]/Santé publique et épidémiologieThrombolysisOdds ratioMiddle Agedmedicine.diseasestrokeConfidence interval3. Good healthTreatment OutcomeNeurologyTissue Plasminogen ActivatorEmergency medicineoutcomeFemale[SDV.SPEE]Life Sciences [q-bio]/Santé publique et épidémiologieNeurology (clinical)FrancePatient Safetyprognosistelemedicinebusiness030217 neurology & neurosurgery
researchProduct

Couples' Experience of the Decision-Making Process in Breast Reconstruction After Breast Cancer: A Lexical Analysis of Their Discourse

2020

Background One in 3 women with breast cancer will have a mastectomy and face the decision of whether to have breast reconstruction (BR). This decision is shared by the women and their physician, as well as discussed with her partner. Objective This study aimed to understand the decision-making process of BR through a lexical analysis of the women and their partners' discourse. A secondary aim was to identify the differences between the couples when the woman had, or did not have, BR. Methods We conducted semistructured interviews with 9 women, and their partners, who underwent a mastectomy after a first episode of breast cancer. A lexical analysis using IRaMuTeQ software was carried out. Re…

AdultMalemedicine.medical_treatmentMammaplastyDecision MakingMEDLINETemporalityBreast NeoplasmsSEPIADevelopmental psychology03 medical and health sciences0302 clinical medicineBreast cancermedicineHumansDecision-makingMastectomyAgedFirst episode030504 nursingOncology (nursing)business.industryBody modificationMiddle Agedmedicine.disease3. Good healthSexual PartnersOncology030220 oncology & carcinogenesisFemale[SDV.SPEE]Life Sciences [q-bio]/Santé publique et épidémiologie0305 other medical sciencebusinessBreast reconstructionMastectomy
researchProduct

Degree of Postictal Suppression Depends on Seizure Induction Time in Magnetic Seizure Therapy and Electroconvulsive Therapy.

2017

OBJECTIVES Anesthesia is required for both magnetic seizure therapy (MST) and electroconvulsive therapy (ECT), although it has anticonvulsant properties. In this case, bispectral index (BIS) monitoring, a specific electroencephalogram-derived monitoring, can be used to find the optimal seizure induction time during anesthesia to elicit adequate seizures. A measurement of seizure adequacy in electroencephalogram is the postictal suppression. The purpose of this study was to investigate the influence of seizure induction time on the degree of postictal suppression by comparing BIS versus no-BIS monitoring in MST and ECT. METHODS Twenty patients with treatment-resistant depression were randoml…

AdultMalemedicine.medical_treatmentNeuroscience (miscellaneous)law.invention03 medical and health sciencesDepressive Disorder Treatment-Resistant0302 clinical medicineElectroconvulsive therapyConsciousness MonitorsElectromagnetic FieldsRandomized controlled triallawPredictive Value of TestsSeizuresmedicineHumansAnesthesiaProspective StudiesElectroconvulsive TherapyAgedPsychiatric Status Rating ScalesCross-Over Studiesbusiness.industryElectroencephalographyMiddle AgedCrossover study030227 psychiatryPsychiatry and Mental healthAnticonvulsantTreatment OutcomeMagnetic seizure therapyBispectral indexAnesthesiaBrain stimulationFemaleAnalysis of variancebusinesshuman activities030217 neurology & neurosurgeryThe journal of ECT
researchProduct

Able or unable to work? : Life trajectory after severe occupational injury

2018

Purpose: To study the probabilities and permanence of return to work, inability to work and rehabilitation, and to explore the connection between these life situations and later working after a sev...

AdultMalework disability030506 rehabilitationAdolescentKansanterveystiede ympäristö ja työterveys - Public health care science environmental and occupational healthmedicine.medical_treatmentOccupational injuryApplied psychologyKansantaloustiede - EconomicsReturn to workrehabilitationCohort StudiesLife Change EventsYoung Adult03 medical and health sciencesInjury Severity ScoreReturn to Work0302 clinical medicinemedicineHumansDisabled PersonsRegistriesFinlandAgedRetirementRehabilitationWork disabilityRehabilitationAge Factorsoccupational injuriesreturn to workMiddle Agedmedicine.diseaseOccupational InjuriesWork lifeConnection (mathematics)Work (electrical)UnemploymentIncomeTrajectoryFemale0305 other medical sciencePsychology030217 neurology & neurosurgery
researchProduct

The role of overweight in the association between the Mediterranean diet and the risk of type 2 diabetes mellitus: a mediation analysis among 21 585 …

2020

Abstract Background There is growing evidence that the Mediterranean (Medi) diet may lower the risk of type 2 diabetes mellitus (T2DM). Whether this association is due to the Medi diet by itself or is mediated by a diet-associated lower rate of overweight is uncertain. Our aim was to disentangle these relationships among UK adults. Methods Based on 21 585 participants from the UK Biobank cohort, the adherence to the Medi diet (high fruits, vegetables, legumes, cereals, fish, olive oil; low meat, dairy products; and intermediate alcohol intakes) was assessed (range 0–18). Data on diabetes were self-reported, and overweight was defined as a body mass index (BMI) ≥ 25 kg/m². A mediation analys…

AdultMediterranean dietEpidemiologytype 2 diabetes mellitus030209 endocrinology & metabolismOverweightLower riskDiet Mediterranean03 medical and health sciencesBMI0302 clinical medicineDiabetes mellitusMediterranean dietmedicineAnimalsHumansoverweight030212 general & internal medicinemediation analysisBiological Specimen Banks2. Zero hungerdiabetesbusiness.industryHazard ratioType 2 Diabetes Mellitusnutritional and metabolic diseasesGeneral Medicine[SDV.MHEP.EM]Life Sciences [q-bio]/Human health and pathology/Endocrinology and metabolism16. Peace & justicemedicine.diseaseUnited Kingdom3. Good healthDiabetes Mellitus Type 2Cohort[SDV.SPEE]Life Sciences [q-bio]/Santé publique et épidémiologiemedicine.symptombusinessBody mass index[SDV.AEN]Life Sciences [q-bio]/Food and NutritionDemography
researchProduct

Olfactory Event-Related Potentials Reflect Individual Differences in Odor Valence Perception

2006

Investigating the neural substrates of perceived quality in olfaction using different odorants is intrinsically difficult. By utilizing individual differences in perceived quality of the odor of androstenone, we obtained a continuum of individual differences in rated valence of the same stimulus allowing investigations of its manifestation in the olfactory event-related potentials (ERPs). In an initial group consisting of 43 individuals that were screened for their verbal descriptors and sensitivity for the odor of androstenone, 22 normosmic volunteers were chosen forming 2 distinct groups with regard to verbal labels (‘‘body odor'' and ‘‘nonbody odor'') for androstenone while maintaining c…

Adultmedicine.medical_specialtyAdolescentPhysiologyandrostenonemedia_common.quotation_subjectOlfactionStimulus (physiology)AudiologyAndrosterone050105 experimental psychologyDevelopmental psychologypleasantness03 medical and health sciencesBehavioral Neurosciencechemistry.chemical_compound0302 clinical medicineEvent-related potentialPhysiology (medical)PerceptionmedicineHumans0501 psychology and cognitive sciencesvalenceValence (psychology)Evoked PotentialsLate positive componentmedia_common[SCCO.NEUR]Cognitive science/Neurosciencemusculoskeletal neural and ocular physiology05 social sciencesAndrostenoneOlfactory PathwaysMiddle AgedSensory SystemsElectrophysiologyOdorchemistryqualitySensory ThresholdsOdorants[ SCCO.NEUR ] Cognitive science/NeuroscienceFemalePsychologypsychological phenomena and processes030217 neurology & neurosurgeryhedonicolfactionChemical Senses
researchProduct